DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and lats2

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001116779.1 Gene:lats2 ZFINID:ZDB-GENE-050119-6 Length:1140 Species:Danio rerio

Alignment Length:1216 Identity:456/1217 (37%)
Similarity:585/1217 (48%) Gaps:346/1217 (28%)


  Fly    14 DKYTAEALESIKQ---DLTRFEVQNNHRNNQNYTPLRYTATNGRNDALTPDYHHAKQPMEP---- 71
            |.:|.:.:..|||   ..:......:||          ||..|..|...|.||....|:..    
Zfish   147 DPHTEQIVRVIKQTSPGKSGMPSLMDHR----------TAMEGSGDGALPPYHQMGAPLYEGASY 201

  Fly    72 --------------------PPSASPAPDVVIPPPPAIVGQP---GAGSISV------------- 100
                                ||.|:|:..|.:..|   :|:|   ||.|.::             
Zfish   202 GAEGEMARAYMGGPPVMNYMPPPANPSQGVTMGNP---MGRPASMGAYSTNMAPQNNTGNPMYTP 263

  Fly   101 ---------SGVGVGVVGVANGRVPKMMTALMPNKLIRKPSIERDTASSHY-LRCSPALDSGAGS 155
                     ||:...::|.:....|..:.:        :||   ....:|| .|.....:|..|.
Zfish   264 GPAQQKGYPSGIDQAMMGYSVSGPPMQIQS--------QPS---GGPGAHYDYRSHMMENSSYGV 317

  Fly   156 SRSDSPHSHHTHQPSSRTVGNPG------GNGGFSPSPSGFSEVAPPAPPPRNPTACSAATPPPP 214
            .||.|..:......:...|..||      ..||::|     :...||...||..:          
Zfish   318 KRSASFQNKMPQLTTENYVNMPGKAAMGQNAGGYAP-----NLYLPPHSHPRQAS---------- 367

  Fly   215 VPPTSQAYVKRRSPALNNRPPAIAPPTQRGNSPVITQNGLKNPQQQLTQQLKSLNL------YPG 273
             |.:.|.::.:       |||.:||....|....:       ||..||....||||      :||
Zfish   368 -PTSHQVHMMQ-------RPPGVAPGAMGGEFSDV-------PQGLLTPSRASLNLDLYEHHWPG 417

  Fly   274 --GGSGAVVEPPPPYLIQGGAGGAAPPPPPPSYTASMQSRQSPTQSQQSDYRKSPSSGIYS--AT 334
              |..|.    ||....||...|..   ..||.|.|..:.|..|..|    ...|::.:..  .:
Zfish   418 AQGPEGT----PPARQPQGPFRGEV---RVPSRTNSFNNHQKVTVRQ----TLPPTASVAGKPES 471

  Fly   335 SAGSPSPIT-VSLPPAPLAKPQPRVYQARSQQPIIMQSVKSTQVQKPVLQTAVAPQSPSSASASN 398
            |.|.|:.|| |:.||                   |...|||.:|.:|..:|||.|..|...||.:
Zfish   472 SLGPPNTITAVTSPP-------------------IQPPVKSIRVMRPEPKTAVGPCHPGWLSAQS 517

  Fly   399 SPVHVLAAPPSYPQKSAAVVQQQQQAAAAAHQQQHQHQQSKPPTPTTPPLVGLNSKPNCLEPPSY 463
            ...          |.|...:..:....    :...:|:...||.|.|..:.|...:|..|||.:.
Zfish   518 PEA----------QDSLGYIPDENFTL----EPSQEHRCPPPPYPKTLLVSGSGPEPASLEPVAM 568

  Fly   464 AKSMQAKAATVVQQQQQQQQQQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRER 528
            : .:|..:||           .:.:|...|.:|::                            ..
Zfish   569 S-GLQDVSAT-----------GRTIQSSSVGKQEE----------------------------PI 593

  Fly   529 ERDQQKLANGNPGRQMLPPPPYQSNNNNNSEIKPPSCNNNNIQISNSNLATTPPIPPAKYNNNSS 593
            .:|:.|:..|                                                       
Zfish   594 FKDKVKMGKG------------------------------------------------------- 603

  Fly   594 NTGANSSGGSNGSTGTTASSSTSCKKIKHASPIPERKKISKEKEEERKEFRIRQYSPQAFKFFME 658
                              ..:...||....||:|.||   ..::||::|.||:.|||.||||:||
Zfish   604 ------------------EKAVKDKKQIQTSPVPVRK---NARDEEKRESRIKSYSPFAFKFYME 647

  Fly   659 QHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLK 723
            ||:|||:|:|:|:..|:.|||:||.|.||.:..|.:|||||.||||||.||:|||||||||||:|
Zfish   648 QHVENVMKTYQQKLNRRMQLEQEMSKAGLSEAEQEQMRKMLYQKESNYNRLRRAKMDKSMFVKIK 712

  Fly   724 PIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQ 788
            .:|:||||||.|..|:|| ..|||||||||.|||.|||||||||||||||||||.|||:||||||
Zfish   713 TLGIGAFGEVCLTRKVDT-GALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVRLYYSFQ 776

  Fly   789 DKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDR 853
            |:||||||||||||||:|||||::|:|.|.|||||:||:|.|::||||||||||||||||||||.
Zfish   777 DRDNLYFVMDYIPGGDMMSLLIRMGVFPEVLARFYVAELTLAIESVHKMGFIHRDIKPDNILIDL 841

  Fly   854 DGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEP---WEEYS--ENGPKPTVLERRRMRDH 913
            |||||||||||||||||||||||||: |||.|||||||   |::.|  ..|.:...||:|..|.|
Zfish   842 DGHIKLTDFGLCTGFRWTHNSKYYQK-GNHIRQDSMEPSDSWDDVSNCRCGDRLMTLEQRATRQH 905

  Fly   914 QRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEK 978
            ||.|||||||||||||||||.|.|||||||:|||||||:|||||||||||.:|.|.|.||||||.
Zfish   906 QRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTEAQLKVINWEN 970

  Fly   979 TLHIPPQAELSREATDLIRRLCASADKRL-GKSVDEVKSHDFFKGIDF-ADMRKQKAPYIPEIKH 1041
            ||.:|||.:||.||.|:|.:||.||::|| |....|:|:|.||..:|| :::|.|.|||.|:|.|
Zfish   971 TLQVPPQVKLSPEAVDIIGQLCCSAEERLGGNGAGEIKAHPFFSEVDFSSNLRTQPAPYRPKIAH 1035

  Fly  1042 PTDTSNFDPVDPEKLRSNDSTMSSGDDVDQNDRTF------------HGFFEFTFRRFFDDK--- 1091
            |.||||||||:.|  ....:...|||    :.||:            |.|:||||||||||.   
Zfish  1036 PMDTSNFDPVEEE--GGPGAWSDSGD----STRTWDTLCSPHGKHPEHAFYEFTFRRFFDDNGCP 1094

  Fly  1092 ----QP-----------------PDMTDDQA-----------PVYV 1105
                :|                 |::.:::|           ||||
Zfish  1095 FRYPKPLEATQSLSSSDGAGSLKPELEEEEAHEEEEQGEGCEPVYV 1140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 255/380 (67%)
S_TKc 719..1020 CDD:214567 226/307 (74%)
lats2NP_001116779.1 UBA_LATS2 105..145 CDD:270581
Med15 175..>635 CDD:255446 130/664 (20%)
PKc_like 706..1088 CDD:304357 263/390 (67%)
S_TKc 708..1013 CDD:214567 226/307 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0608
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 662 1.000 Inparanoid score I720
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoFinder 1 1.000 FOG0002438
OrthoInspector 1 1.000 T597249
orthoMCL 1 0.900 OOG5_126822
Panther 1 1.100 LDO PTHR24356
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.