DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and lats1

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001018346.1 Gene:lats1 ZFINID:ZDB-GENE-050523-2 Length:1068 Species:Danio rerio

Alignment Length:1216 Identity:478/1217 (39%)
Similarity:594/1217 (49%) Gaps:368/1217 (30%)


  Fly     3 PAGEKRGGR---PNDKYTAEALESIKQDLTRFEVQNNHRNNQNYTPLRYTATNGRNDALTPDYHH 64
            |...::.||   |.:.:...||:.|::.|               .|..:.:::..:::......|
Zfish    59 PDESRQQGRSTNPRNSHHHRALQEIRKSL---------------QPFAHDSSSSGDNSSADSSKH 108

  Fly    65 AKQPMEPP--------------------PSASPAPDVVIPPPPAIVGQPGAGSISVSGVGVGVVG 109
            ..|..||.                    |||.|....:....|..:.||                
Zfish   109 TLQTQEPGFDEELMVNRINFQEAVREQIPSARPVNTAIKQAGPPQIQQP---------------- 157

  Fly   110 VANGRVPKMMTALMPNKLIRKPSIERDTASSHYLRCSPALDSGAGSSRSDSPHSHHT-------H 167
                             |:|:                   .|..||..|.:|..|..       :
Zfish   158 -----------------LLRR-------------------QSWKGSKESLAPQRHSALINDVLIY 186

  Fly   168 QPSSRTVGNPGGNGGFSPSPSGFSEVAPPAPPPRNPTACSA-------------ATPPPPVPPTS 219
            :||             ||.|.  |:::.||..|:|..:.|:             :..|||....|
Zfish   187 RPS-------------SPGPQ--SDLSRPATFPQNLASASSGQRVNAPLSRQVRSITPPPSSWDS 236

  Fly   220 QAYVKRRSPALNNRPPAIAPPTQ--RGNSPVITQNGLKNPQQQLTQQLKSLNLYPGGGSGAVVEP 282
            ....||.|..|:...|.|:|..|  ||       :|..|||   :|..:.|...|.|....:::.
Zfish   237 NPSTKRYSGNLDYLVPRISPVPQGPRG-------DGYINPQ---SQNQRGLRPVPVGRQPIIMQN 291

  Fly   283 P-------PPYLIQGGA---------GGAAPPPPPPSYTASMQSRQSPT-QSQQSDYRKSPSSGI 330
            .       ||...|.|:         .||..||||| |:....:||||| |..||....:|.:|.
Zfish   292 SNSNKFNFPPSWPQNGSMQNEYMGMNSGARQPPPPP-YSMHQTNRQSPTAQQMQSSALTAPPNGA 355

  Fly   331 YSATSAGSPSPITVSLPPAPLAKPQPRVYQAR--------------------------------- 362
            ....|...|:..:.:|....|...:|.|.||:                                 
Zfish   356 SLPQSMLVPNRNSHNLDMYNLGVIRPPVQQAQTPPGQDTSSSWTHSVPGRSNSFTSAPNNRRQCP 420

  Fly   363 ------------SQQPIIMQSVKSTQVQKPVLQTAVAPQSPSSASASNSPVHVLAAPPSYPQKSA 415
                        :|.| |:|.|||.:||||.|.|||||..|.          .|..||       
Zfish   421 NSQLSATTVTTVTQAP-ILQPVKSMRVQKPELHTAVAPAHPP----------WLQPPP------- 467

  Fly   416 AVVQQQQQAAAAAHQQQHQHQQSKPPTPTTPPLVGLNSKPNCLEPPSYAKSMQAKAATVVQQQQQ 480
                      ..|:|:        ||||..|          ..|.|||..........::|||| 
Zfish   468 ----------PTAYQE--------PPTPPAP----------AAEVPSYQGPPPPYPKHLLQQQQ- 503

  Fly   481 QQQQQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQKLANGNPGRQML 545
                                                                             
Zfish   504 ----------------------------------------------------------------- 503

  Fly   546 PPPPYQSNNNNNSEIKPPSCNNNNIQISNSNLATTPPIPPAKYNNNSSNTGANSSGGSNGSTGTT 610
            |||.|.|    :..:||  |:...               .|..|.|.:::..:|.         .
Zfish   504 PPPGYDS----SPALKP--CSKEG---------------DAADNENDTDSTCSSE---------R 538

  Fly   611 ASSSTSCKKIKHASPIPERKKISKEKEEERK-EFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYR 674
            |..|...||....||:|.|:   .:::|||| |.|:..|||||||||||||:||::|:::||..|
Zfish   539 AEGSEEEKKQITTSPVPVRR---HKRDEERKGESRLPMYSPQAFKFFMEQHVENILKNHQQRMRR 600

  Fly   675 KNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKI 739
            |.|||.||.:|||....|.:||.||:||||||||||||||||.||.|:|.:|:||||||.|..|:
Zfish   601 KKQLESEMQRVGLSGDAQEQMRMMLSQKESNYIRLKRAKMDKCMFEKIKTLGIGAFGEVCLARKV 665

  Fly   740 DTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGD 804
            || ..|||||||||.|||.|||||||||||||||||||.|||:||||||||||||||||||||||
Zfish   666 DT-GALYAMKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGD 729

  Fly   805 LMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFR 869
            :|||||::|||:|:||:|||||:.|||:|||||||||||||||||||||||||||||||||||||
Zfish   730 MMSLLIRMGIFQEDLAQFYIAELICAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFR 794

  Fly   870 WTHNSKYYQENGNHSRQDSME---PWEEYSEN---GPKPTVLERRRMRDHQRVLAHSLVGTPNYI 928
            |||:||||| :|:|.|||||:   .||: |.|   |.:...||||..|.|||.||||||||||||
Zfish   795 WTHDSKYYQ-SGDHVRQDSMDFSMEWED-SANCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYI 857

  Fly   929 APEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREAT 993
            |||||.|:|||||||:||||||||||:||||||||.:|||||.|||.|:.:||||.||:||.|||
Zfish   858 APEVLLRTGYTQLCDWWSVGVILYEMVVGQPPFLATTPLETQMKVIRWQTSLHIPLQAKLSPEAT 922

  Fly   994 DLIRRLCASADKRLGKS-VDEVKSHDFFKGIDFA-DMRKQ-KAPYIPEIKHPTDTSNFDPVDPEK 1055
            |||.:||...|.|||:: .||:|:..||:.||.: |:|:| :|||||:|.|.|||||||||||:|
Zfish   923 DLILKLCRGPDDRLGRNGADEIKAQPFFRTIDLSKDLRQQHQAPYIPKITHSTDTSNFDPVDPDK 987

  Fly  1056 LRSNDSTMSSGDDVDQNDRTF-------HGFFEFTFRRFFDDKQPP 1094
            |.|.|   :.|:..|...|.|       |.|:||||||||||...|
Zfish   988 LWSED---ADGNHNDTLTRWFKNGKHPEHAFYEFTFRRFFDDSGHP 1030

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 264/377 (70%)
S_TKc 719..1020 CDD:214567 230/308 (75%)
lats1NP_001018346.1 PKc_like 644..1024 CDD:304357 272/386 (70%)
S_TKc 645..950 CDD:214567 230/308 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C340273353
eggNOG 1 0.900 E1_KOG0608
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoFinder 1 1.000 FOG0002438
OrthoInspector 1 1.000 T597249
orthoMCL 1 0.900 OOG5_126822
Panther 1 1.100 O PTHR24356
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4821
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.