DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and Lats2

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_056586.2 Gene:Lats2 MGIID:1354386 Length:1042 Species:Mus musculus

Alignment Length:1121 Identity:444/1122 (40%)
Similarity:549/1122 (49%) Gaps:307/1122 (27%)


  Fly    92 QPGAGSISVSGVGVGVVGVANGRVPKMM---------TALMPNKLIRKPSIE---RDTASSHYLR 144
            |.|:.||..:...:..:|..:.|..:::         ..|.|..:.|:||.|   ....|.|.|.
Mouse   122 QTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLAPTPVTRRPSFEGTGEALPSYHQLG 186

  Fly   145 CS----PA---------LD-----SGAGSSRSDSPHSHHTHQ-----------PSSRTVGNPGGN 180
            .:    ||         ||     :|||:      |....||           ||:...|...|.
Mouse   187 GANYEGPAALEEMPRQYLDFLFPGAGAGT------HGAQAHQHPPKGYSTAVEPSAHFPGTHYGR 245

  Fly   181 GG-FSPSP-------SGFSEVAPPAPPPRNPTACSAATPPPPVPPTSQAYVKRRSPA------LN 231
            |. .|..|       |.|....|       |.|.|:.......||.|..:     ||      .:
Mouse   246 GHLLSEQPGYGVQRSSSFQNKTP-------PDAYSSMAKAQGGPPASLTF-----PAHAGLYTAS 298

  Fly   232 NRPPAIAPPTQRGNSPV-------ITQNGLKNPQQQLTQQLKSLN--LYPGGGSGAVVEPPPPYL 287
            :..||..||   |..|:       .|..|..:.|..|.....|||  ||.               
Mouse   299 HHKPAATPP---GAHPLHVLGTRGPTFTGESSAQAVLAPSRNSLNADLYE--------------- 345

  Fly   288 IQGGAGGAAPPPPPPSYTASMQSRQSPTQSQQSD-------YRKSPSSGIYSATSAGSPSPITVS 345
                .|...|      ::|:..:|:...|.|..:       :|..||    ...|..:|.|    
Mouse   346 ----LGSTVP------WSAAPLARRDSLQKQGLEASRPHVAFRAGPS----RTNSFNNPQP---- 392

  Fly   346 LPPAPLAKPQPRVYQARSQQPIIMQSVKSTQVQKPVLQTAVAPQSPSSASASNSPVHVLAAPPSY 410
            .|..|.......|..|.     |:..|||.:|.:|..||||.|..|:..:|..:|          
Mouse   393 EPSLPAPNTVTAVTAAH-----ILHPVKSVRVLRPEPQTAVGPSHPAWVAAPTAP---------- 442

  Fly   411 PQKSAAVVQQQQQAAAAAHQQQHQHQQSKPPTPTTPPLVGLNSKPNCLEPPSYAKSMQAKAATVV 475
                |....:.::.:|..|.....:..|:...|                ||.|.|.:        
Mouse   443 ----ATESLETKEGSAGPHPLDVDYGGSERRCP----------------PPPYPKHL-------- 479

  Fly   476 QQQQQQQQQQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQKLANGNP 540
                            .:..:.:|....|.:|.....|:.|...:::|..:..:           
Mouse   480 ----------------LLPSKSEQYSVDLDSLCTSVQQSLRGGTEQDRSDKSHK----------- 517

  Fly   541 GRQMLPPPPYQSNNNNNSEIKPPSCNNNNIQISNSNLATTPPIPPAKYNNNSSNTGANSSGGSNG 605
                                                                            |
Mouse   518 ----------------------------------------------------------------G 518

  Fly   606 STGTTASSSTSCKKIKHASPIPERKKISKEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQ 670
            :.|..|...   ||....||:|.||   ..::||::|.||:.|||.|||||||||:|||||:|:|
Mouse   519 AKGDKAGRD---KKQIQTSPVPVRK---NSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQ 577

  Fly   671 RTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTL 735
            :..|:.|||:||.|.||.:..|.:|||:|.||||||.||||||||||||||:|.:|:||||||.|
Mouse   578 KVSRRLQLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCL 642

  Fly   736 VSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYI 800
            ..|:|| :.|||||||||.|||.|||||||||||||||||||.|||||||||||||:||||||||
Mouse   643 ACKLDT-HALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYI 706

  Fly   801 PGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLC 865
            ||||:|||||::.:|.|.||||||||:|.|::||||||||||||||||||||.||||||||||||
Mouse   707 PGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLC 771

  Fly   866 TGFRWTHNSKYYQENGNHSRQDSMEP---WEEYS--ENGPKPTVLERRRMRDHQRVLAHSLVGTP 925
            |||||||||||||: |||.|||||||   |::.|  ..|.:...||:|..:.|||.|||||||||
Mouse   772 TGFRWTHNSKYYQK-GNHMRQDSMEPGDLWDDVSNCRCGDRLKTLEQRAQKQHQRCLAHSLVGTP 835

  Fly   926 NYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSR 990
            ||||||||.|.|||||||:|||||||:|||||||||||.:|.|||.||||||.|||||.|..||.
Mouse   836 NYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKVINWESTLHIPTQVRLSA 900

  Fly   991 EATDLIRRLCASADKRLGK-SVDEVKSHDFFKGIDFA-DMRKQKAPYIPEIKHPTDTSNFDPVDP 1053
            ||.|||.:||.:||.|||: ..|::|:|.||..|||: |:|||.|||:|.|.||.|||||||||.
Mouse   901 EARDLITKLCCAADCRLGRDGADDLKAHPFFNTIDFSRDIRKQPAPYVPTISHPMDTSNFDPVDE 965

  Fly  1054 EK---LRSNDS-----TMSSGDDVDQNDRTFHGFFEFTFRRFFDD----------KQPPDMTDDQ 1100
            |.   ..|.:|     |::|    ..:....|.|:||||||||||          .:|.:..|..
Mouse   966 ESPWHEASGESAKAWDTLAS----PSSKHPEHAFYEFTFRRFFDDNGYPFRCPKPSEPAESADPG 1026

  Fly  1101 -----------APVYV 1105
                       .||||
Mouse  1027 DADLEGAAEGCQPVYV 1042

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 261/376 (69%)
S_TKc 719..1020 CDD:214567 229/307 (75%)
Lats2NP_056586.2 UBA_LATS2 100..140 CDD:270581 5/18 (28%)
PPxY motif 472..475 2/3 (67%)
PKc_like 624..1004 CDD:304357 269/386 (70%)
S_TKc 626..931 CDD:214567 229/307 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0608
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 688 1.000 Inparanoid score I691
Isobase 1 0.950 0 Normalized mean entropy S1496
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002438
OrthoInspector 1 1.000 T616412
orthoMCL 1 0.900 OOG5_126822
Panther 1 1.100 LDO PTHR24356
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.770

Return to query results.
Submit another query.