DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and stk38a

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_998621.1 Gene:stk38a ZFINID:ZDB-GENE-040426-2811 Length:468 Species:Danio rerio

Alignment Length:447 Identity:205/448 (46%)
Similarity:291/448 (65%) Gaps:33/448 (7%)


  Fly   654 KFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSM 718
            |..:|....|:|..:.:|..|:.:|||.|.:.||.|:.:...|....:||:.::||||.::....
Zfish    24 KVTLENFYSNLISQHEEREMRQQKLEKVMDQEGLADEEKRLRRSEHARKETEFLRLKRTRLGLED 88

  Fly   719 FVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKL 783
            |..||.||.||||||.||.|.|| .|:||||.|||||:|::.||.|::||||||.|||:.||||:
Zfish    89 FESLKVIGRGAFGEVRLVQKKDT-GHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKM 152

  Fly   784 YYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDN 848
            :||||||.|||.:|:::||||:|:||:|.....||..:|||||...|:||:|::|||||||||||
Zfish   153 FYSFQDKMNLYLIMEFLPGGDMMTLLMKKDTLTEEATQFYIAETVLAIDSIHQLGFIHRDIKPDN 217

  Fly   849 ILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHS--------RQDSMEPWEEYSENGPKPTVL 905
            :|:|..||:||:|||||||.:..|.:::|: |.|||        ..:|....|.:..|       
Zfish   218 LLLDSRGHVKLSDFGLCTGLKKAHRTEFYR-NLNHSLPSDFTFQNMNSKRKAETWKRN------- 274

  Fly   906 ERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQ 970
                    :|.||.|.||||:||||||..::||.:|||:||:|||:||||:|.|||.:.:|.||.
Zfish   275 --------RRQLAFSTVGTPDYIAPEVFMQNGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETY 331

  Fly   971 QKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGKS-VDEVKSHDFFKGIDFADMRKQKAP 1034
            :||:||.:||..||:..:|.:|.|||.|.|...:.|:|.: |:|:|::.||:|:|:..:|::.|.
Zfish   332 RKVMNWRETLIFPPEVPISEKAKDLILRFCCEGEHRIGATGVEEIKTNAFFEGVDYDHIRERPAA 396

  Fly  1035 YIPEIKHPTDTSNFDPV-DPEKLRSNDSTMSSGD---DVDQNDRTFHGFFEFTFRRF 1087
            ...|||...||||||.. |.:.|:.:.:|:.|..   |:...|..   |..:|::||
Zfish   397 IPIEIKSIDDTSNFDEFPDSDILQPSATTVVSNHTEADLKSKDWV---FINYTYKRF 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 181/374 (48%)
S_TKc 719..1020 CDD:214567 161/310 (52%)
stk38aNP_998621.1 STKc_NDR1 87..464 CDD:270777 185/385 (48%)
S_TKc 89..382 CDD:214567 161/310 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126822
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.