DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and trc

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001262071.1 Gene:trc FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster

Alignment Length:436 Identity:193/437 (44%)
Similarity:283/437 (65%) Gaps:8/437 (2%)


  Fly   654 KFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSM 718
            |..:|.:..|::..|.:|..|..:||.::....|.:..:.|.|....|||:.|:||||.::....
  Fly    28 KVTLENYYSNLVTQYGERKQRLAKLEAQLKDESLSEAQRQEKRLQHAQKETEYLRLKRLRLGVED 92

  Fly   719 FVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKL 783
            |..||.||.||||||.||.|.|| .|:||||.|||||:|::.|||||:||||:|.|||:.||||:
  Fly    93 FEALKVIGRGAFGEVRLVQKKDT-GHVYAMKVLRKADMLEKEQVAHVRAERDVLVEADHQWVVKM 156

  Fly   784 YYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDN 848
            ||||||..|||.:|:::||||:|:||:|.....||..:|||:|...|:||:||:|||||||||||
  Fly   157 YYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDN 221

  Fly   849 ILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDH 913
            :|:|..||:||:|||||||.:.:|.:.:|::.......|.:......| ..|..:.......:.:
  Fly   222 LLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCASLS-CSPMDSKRRAESWKRN 285

  Fly   914 QRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEK 978
            :|.||:|.||||:||||||..::||...||:||:|||:||||:|.|||.:::|.:|.:||:||.:
  Fly   286 RRALAYSTVGTPDYIAPEVFLQTGYGPACDWWSLGVIMYEMLMGYPPFCSDNPQDTYRKVMNWRE 350

  Fly   979 TLHIPPQAELSREATDLIRRLCASADKRLG--KSVDEVKSHDFFKGIDFADMRKQKAPYIPEIKH 1041
            ||..||:..:|.||.:.|...|..||:|||  :.::::||..||:|:|:..:|::.|....|::.
  Fly   351 TLIFPPEIPISEEAKETIINFCCEADRRLGSQRGLEDLKSVPFFRGVDWEHIRERPAAIPVEVRS 415

  Fly  1042 PTDTSNFDPVDPEKLRSNDSTMSSGDDVDQNDRTFHGFFEFTFRRF 1087
            ..||||||......|....:.:..|.::.::    ..|..:|::||
  Fly   416 IDDTSNFDEFPDVSLEIPSAPIPQGGEIAKD----WVFINYTYKRF 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 170/363 (47%)
S_TKc 719..1020 CDD:214567 156/303 (51%)
trcNP_001262071.1 OmpH 16..>85 CDD:332039 18/57 (32%)
STKc_NDR_like 91..455 CDD:270750 172/370 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216969at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126822
Panther 1 1.100 P PTHR24356
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.