DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and Lats1

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001128015.2 Gene:Lats1 RGDID:1564085 Length:1130 Species:Rattus norvegicus

Alignment Length:1278 Identity:503/1279 (39%)
Similarity:609/1279 (48%) Gaps:379/1279 (30%)


  Fly     5 GEKRGGR--------PNDKYTA-------EALESIK-----QDLTRFEVQNNHRNNQNYTPLRYT 49
            |||..|.        |...|:.       |..||::     .|..:.|...|..:.::...:|..
  Rat     4 GEKPEGYRQMRPKTFPASNYSGSSRQMLQEIRESLRNLSKPSDAAKAEHNLNKMSTEDPRQVRNP 68

  Fly    50 ATNGRNDALTPDYHHAKQPMEPPPSASPAPDVVIPPPPAIVGQPGAG----------------SI 98
            ...|.:.....:..::..|.....|:|..|..|  .|........||                ||
  Rat    69 PKFGTHHKALQEIRNSLLPFANETSSSRIPSEV--NPQMFQDLQAAGFDEDMVIQALQKTNNRSI 131

  Fly    99 SVSGVGVGVVGVANGRVPKM-MTALMPNKLIRKP-----SIERDTASSHYLRCSPALDSGAGSSR 157
            ..:...:..:...:.|..:| ..|..|.....||     ||.|.             .|..||..
  Rat   132 EAAVEFISKMSYQDPRREQMAAAAARPINATMKPGNVQHSISRK-------------QSWKGSKE 183

  Fly   158 SDSPHSH----------HTHQPSSRT-VGNPGGNGGFS---------------PSPSGFSEVAPP 196
            |..|..|          .:..|:|:. ||.|....|.:               |.|.....|.||
  Rat   184 SLVPQRHGPSLGENVVYRSESPNSQADVGRPLSGSGITAFAQAHPSNGQRVNPPPPPQVRSVTPP 248

  Fly   197 APPPRNPTACSAATPPPPV--PPTSQA--------YVKRR--------------SPALNNRPPAI 237
             ||||..|.....|.|||.  .|.||.        ||..|              .|.||..|  :
  Rat   249 -PPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPLNTSP--M 310

  Fly   238 APPTQR---------GNSPVITQN-----------GLKNPQQQLTQQLKSLNLYPGGGSGAV-VE 281
            .||.|.         |..|:|.|:           |::|...| |..:...|:.|   :||| .:
  Rat   311 NPPNQGQRGISSVPVGRQPIIMQSTSKFNFTPGRPGVQNGGGQ-TDFIMHQNVVP---TGAVNRQ 371

  Fly   282 PPPPY-----------LIQGGAGGAAPP-------PP-------------------PPSYTASMQ 309
            |||||           .:|.| |.||||       ||                   |...|...|
  Rat   372 PPPPYPLTPANGQSPSALQAG-GPAAPPSFSNGNVPPTMMVPNRNSHNMELYNINVPGLQTTWPQ 435

  Fly   310 SRQSPTQSQQSDYRKSP------------------SSGIYSATSAGSPSPITVSLPPAPLAKPQP 356
            |..:|.||..|...:.|                  |...:||.|..|.:.:| ::.|||:     
  Rat   436 SSSAPVQSSPSSGHEIPTWQPNIPVRSNSFNNPLGSRASHSANSQPSATTVT-AITPAPI----- 494

  Fly   357 RVYQARSQQPIIMQSVKSTQVQKPVLQTAVAPQSPSSASASNSPVHVLAAPPSYPQKSAAVVQQQ 421
                   |||     |||.:|.||.||||:||..||...   .||..: .|..:.:.:|:.|   
  Rat   495 -------QQP-----VKSMRVLKPELQTALAPTHPSWMP---QPVQTV-QPSPFSEGAASNV--- 540

  Fly   422 QQAAAAAHQQQHQHQQSKPPTPTTPPLVGLNSKPNCLEPPSYAKSMQAKAATVVQQQQQQQQQQQ 486
                                 |..||:.         |.|||..                     
  Rat   541 ---------------------PVIPPVA---------EAPSYQG--------------------- 554

  Fly   487 QVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQKLANGNPGRQMLPPPPYQ 551
                                                                       |||||.
  Rat   555 -----------------------------------------------------------PPPPYP 560

  Fly   552 SNNNNNSEIKPPSCNNNNIQISNSNLATTPPIPPAKYNNNSSNTGANSSGGSNGSTGTTASSSTS 616
            .:                      .|..||.:||.:..:........||.....|..:..|..:.
  Rat   561 KH----------------------LLHQTPSVPPYESASKPCKDDQPSSAKEEDSEKSLDSVDSG 603

  Fly   617 CKKIKH--ASPIPERKKISKEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYRKNQLE 679
            .|:.|.  .|||..||   .:|:|||:|.||:.|||||||||||||:|||:||::||.:||.|||
  Rat   604 DKEKKQITTSPITVRK---NKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLE 665

  Fly   680 KEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNH 744
            .||.:|||....|.:|||||.|||||||||||||||||||||:|.:|:||||||.|..|:|| ..
  Rat   666 NEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCLARKVDT-KA 729

  Fly   745 LYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLL 809
            |||.|||||.|||.|||||||||||||||||||.|||:||||||||||||||||||||||:||||
  Rat   730 LYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLL 794

  Fly   810 IKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNS 874
            |::|||.|.||||||||:||||:||||||||||||||||||||||||||||||||||||||||:|
  Rat   795 IRMGIFPENLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDS 859

  Fly   875 KYYQENGNHSRQDSMEPWEEYSEN-----GPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLE 934
            |||| :|:|.|||||:...|:.:.     |.:...||||..|.|||.|||||||||||||||||.
  Rat   860 KYYQ-SGDHPRQDSMDFSSEWGDPSNCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLL 923

  Fly   935 RSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRL 999
            |:|||||||:|||||||:|||||||||||.:|||||.|||||:.:|||||||:||.||:|||.:|
  Rat   924 RTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKL 988

  Fly  1000 CASADKRLGKS-VDEVKSHDFFKGIDF-ADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDST 1062
            |...:.||||: .||:|:|.|||.||| :|:|:|.|.|||:|.|||||||||||||:||      
  Rat   989 CRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKL------ 1047

  Fly  1063 MSSGDDVDQNDRTF-----------HGFFEFTFRRFFDDKQPP 1094
            .|.|::.:..:.|.           |.|:||||||||||...|
  Rat  1048 WSDGNEEENINDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYP 1090

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 265/379 (70%)
S_TKc 719..1020 CDD:214567 231/307 (75%)
Lats1NP_001128015.2 UBA_like_SF 103..143 CDD:304366 5/40 (13%)
STKc_LATS1 703..1084 CDD:270775 273/389 (70%)
S_TKc 705..1010 CDD:214567 231/307 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C340273590
eggNOG 1 0.900 E1_KOG0608
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 694 1.000 Inparanoid score I646
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoFinder 1 1.000 FOG0002438
OrthoInspector 1 1.000 T618531
orthoMCL 1 0.900 OOG5_126822
Panther 1 1.100 O PTHR24356
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.