DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and Lats2

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001100737.1 Gene:Lats2 RGDID:1305906 Length:1042 Species:Rattus norvegicus

Alignment Length:1110 Identity:451/1111 (41%)
Similarity:555/1111 (50%) Gaps:286/1111 (26%)


  Fly    92 QPGAGSISVSGVGVGVVGVANGRVPKMM---------TALMPNKLIRKPSIERDTASSHYLRCSP 147
            |.|:.||..:...:..:|..:.|..:::         ..|:|..:.|:||.|             
  Rat   123 QTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLVPTAVTRRPSFE------------- 174

  Fly   148 ALDSGAGSSRSDSPHSHHTHQPSSRTVG--NPGGNGGFSPSP--------SGFSEVAPPA---PP 199
                |.|.:           .||...:|  |..|.......|        .|.|....||   ||
  Rat   175 ----GTGEA-----------FPSHHQLGGANYEGPAALEEMPRQYLDFLFPGASVHGAPAHQHPP 224

  Fly   200 PRNPTACSAATPPP-------PVPPTSQAYVKRRSPALNNRPPAIAPPTQRGNSPVITQNGLKNP 257
            ....||..|.|..|       .:......|..:|||:..::.|   |.|.  :|....|.|   |
  Rat   225 KGYSTAVDAGTHFPGAHYGRAHLLSEQPGYGVQRSPSFQSKTP---PDTY--SSLAKAQGG---P 281

  Fly   258 QQQLTQQLKSLNLYPGGGS---------GAVVEPPPPYLIQGGAGGAAPPPPPPSYTASMQSRQS 313
            ...||        :|....         .|.|....|..:.|..|        |::|.     .|
  Rat   282 PASLT--------FPAHAGLYTTSHHKPAAAVPGAHPLHVLGTRG--------PTFTG-----DS 325

  Fly   314 PTQSQQSDYRKSPSSGIYSATSAGSPSPITVSLPPAPLAKPQPRVYQARSQQPIIMQSVKSTQVQ 378
            .||:..:..|.|.::.:|   ..|||.|    .|.||||:          :..:..||::::   
  Rat   326 STQAVLAPSRNSLNNDLY---ELGSPVP----WPAAPLAR----------RDSLQKQSLEAS--- 370

  Fly   379 KPVL---------QTAVAPQSPSSASASNSPVHVLAAPPSYPQKSAAVVQQQQQAAAAAHQQQHQ 434
            :|.:         .:..:||...|..|.|:...|.||...:|.||..|::.:.|.|..       
  Rat   371 RPHVAFRAGPSRTNSFSSPQPEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVG------- 428

  Fly   435 HQQSKP---PTPTTPPLV-GLNSKPNCLEPPSYAKSMQAKAATVVQQQQQQQQQQQQVQQQQVQQ 495
              .|.|   |.||.|... ||.||.....||..                                
  Rat   429 --PSHPAWVPAPTAPAAAEGLESKEGSAGPPPL-------------------------------- 459

  Fly   496 QQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQKLANGNPGRQMLPPPPYQSNNNNNSEI 560
                                      :.|....||             ..|||||..:       
  Rat   460 --------------------------DMDFGGSER-------------RCPPPPYPKH------- 478

  Fly   561 KPPSCNNNNIQISNSNLATTPPIPPAKYNNNSSN-----TGANSS--GGS------NGSTGTTAS 612
                                 .:.|:|....|:.     ||...|  ||:      .|..|....
  Rat   479 ---------------------LLLPSKSEQYSAGLDRLCTGVEQSLRGGTEQDRNDKGHKGAKGD 522

  Fly   613 SSTSCKKIKHASPIPERKKISKEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYRKNQ 677
            .:...||....||:|.||   ..::||::|.||:.|||.|||||||||:|||||:|:|:..|:.|
  Rat   523 KAGRDKKQIQTSPVPVRK---NSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVSRRLQ 584

  Fly   678 LEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTS 742
            ||:||.|.||.:..|.:|||:|.||||||.||||||||||||||:|.:|:||||||.|..|:|| 
  Rat   585 LEQEMAKAGLCETEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDT- 648

  Fly   743 NHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMS 807
            :.|||||||||.|||.|||||||||||||||||||.|||||||||||||:||||||||||||:||
  Rat   649 HALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMS 713

  Fly   808 LLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTH 872
            |||::.:|.|.||||||||:|.|::||||||||||||||||||||.|||||||||||||||||||
  Rat   714 LLIRMEVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTH 778

  Fly   873 NSKYYQENGNHSRQDSMEP---WEEYS--ENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEV 932
            ||||||: |||.|||||||   |::.|  ..|.:...||:|..:.|||.||||||||||||||||
  Rat   779 NSKYYQK-GNHIRQDSMEPGDLWDDVSNCRCGDRLKTLEQRAQKQHQRCLAHSLVGTPNYIAPEV 842

  Fly   933 LERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIR 997
            |.|.|||||||:|||||||:|||||||||||.:|.|||.||||||.|||||.|.:||.||.|||.
  Rat   843 LLRKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKVINWENTLHIPTQVKLSAEARDLIT 907

  Fly   998 RLCASADKRLGK-SVDEVKSHDFFKGIDFA-DMRKQKAPYIPEIKHPTDTSNFDPVDPEK---LR 1057
            :||.:||.|||: ..|::|:|.||..|||: |:|||.|||:|.|.||.|||||||||.|.   ..
  Rat   908 KLCCAADCRLGRDGADDLKAHPFFSTIDFSRDIRKQPAPYVPTISHPMDTSNFDPVDEESPWHEA 972

  Fly  1058 SNDSTMSSGDDVDQNDR-TFHGFFEFTFRRFFDD----------KQPPDMTDDQ----------- 1100
            |.:|..:.......|.: ..|.|:||||||||||          .:|.:..|..           
  Rat   973 SGESAKAWDTLASPNSKHPEHAFYEFTFRRFFDDNGYPFRCPKPSEPAESADPGDAELGGAVEGC 1037

  Fly  1101 APVYV 1105
            .||||
  Rat  1038 QPVYV 1042

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 260/372 (70%)
S_TKc 719..1020 CDD:214567 229/307 (75%)
Lats2NP_001100737.1 UBA_LATS2 101..141 CDD:270581 5/18 (28%)
PKc_like 624..1004 CDD:304357 268/382 (70%)
S_TKc 626..931 CDD:214567 229/307 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoFinder 1 1.000 FOG0002438
OrthoInspector 1 1.000 T618531
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24356
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.