DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and LATS2

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_055387.2 Gene:LATS2 HGNCID:6515 Length:1088 Species:Homo sapiens

Alignment Length:1255 Identity:482/1256 (38%)
Similarity:585/1256 (47%) Gaps:356/1256 (28%)


  Fly     3 PAGEKRGGRPNDKYTAEALESIKQDLTRFEVQNNHRNNQNYTPLRYTATNGRNDALTPDYHHAKQ 67
            |||      ||...:.:|.....:|.||.:.|           :|.|...|.......:..::..
Human    38 PAG------PNSDTSLDAKVLGSKDATRQQQQ-----------MRATPKFGPYQKALREIRYSLL 85

  Fly    68 PMEPPPSASPAPDVVIPPPPAIVG-------------QPGAGSISVSGVGVGVVGVANGRVPKMM 119
            |.......|.|.:|.......:|.             |.|:.||..:...:..:|..:.|..:::
Human    86 PFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMGYLDPRNEQIV 150

  Fly   120 ---------TALMPNKLIRKPSIE---RDTASSHYLRCSP------------ALDS--------- 151
                     ..|||..:.|:||.|   ...||.|.|..:|            ||:.         
Human   151 RVIKQTSPGKGLMPTPVTRRPSFEGTGDSFASYHQLSGTPYEGPSFGADGPTALEEMPRPYVDYL 215

  Fly   152 --GAGSSRSDSPHSH---------------------HTHQPSSRTVGNPGGNGGFSPSPSGFSEV 193
              |.|.......|.|                     |..:|.....|.|.|. |...|||..|:.
Human   216 FPGVGPHGPGHQHQHPPKGYGASVEAAGAHFPLQGAHYGRPHLLVPGEPLGY-GVQRSPSFQSKT 279

  Fly   194 AP--------PAPPPRNPTACSAATPPP------PVPPTSQAYVKRRSPA------LNNRPPAIA 238
            .|        |......|.....|.|||      |.|...||     .||      |.:|....|
Human   280 PPETGGYASLPTKGQGGPPGAGLAFPPPAAGLYVPHPHHKQA-----GPAAHQLHVLGSRSQVFA 339

  Fly   239 PPTQRGNSPVITQNGLKNPQQQLTQQLKSLN--LYPGGGSGAVVEPPPPYLIQGGA----GGAAP 297
                 .:||         ||..||....|||  ||. .||.:|.:.|...|.:..:    |..||
Human   340 -----SDSP---------PQSLLTPSRNSLNVDLYE-LGSTSVQQWPAATLARRDSLQKPGLEAP 389

  Fly   298 PP---------PPPSYTASMQSRQSPTQSQQSDYRKSPSSGIYSATSAGSPSPITVSLPPAPLAK 353
            |.         |.||.|.|..|.|             |..|.........|:|.||:...|    
Human   390 PRAHVAFRPDCPVPSRTNSFNSHQ-------------PRPGPPGKAEPSLPAPNTVTAVTA---- 437

  Fly   354 PQPRVYQARSQQPIIMQSVKSTQVQKPVLQTAVAPQSPSSASASNSPVHVLAAPPSYPQKSAAVV 418
                        ..|:..|||.:|.:|..||||.|..|:...|. :|     ||...|..:|..:
Human   438 ------------AHILHPVKSVRVLRPEPQTAVGPSHPAWVPAP-AP-----APAPAPAPAAEGL 484

  Fly   419 QQQQQAAAAAHQQQHQHQQSKPPTPTTPPLVGLNSKPNCLEPPSYAKSMQAKAATVVQQQQQQQQ 483
            ..:::.|.|                    |.|..:.|..:|                        
Human   485 DAKEEHALA--------------------LGGAGAFPLDVE------------------------ 505

  Fly   484 QQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQKLANGNPGRQMLPPP 548
                                                                 .|.|.|: .|||
Human   506 -----------------------------------------------------YGGPDRR-CPPP 516

  Fly   549 PYQSN--NNNNSEIKPPSCNNNNIQISNSNLATTPPIPPAKYNNNSSNTGANSS---------GG 602
            ||..:  ..:.||                           :|:.:|...|...|         ||
Human   517 PYPKHLLLRSKSE---------------------------QYDLDSLCAGMEQSLRAGPNEPEGG 554

  Fly   603 SNGSTGTTASSSTSCKKIKHASPIPERKKISKEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKS 667
            ...............||....||:|.||   ..::||::|.||:.|||.|||||||||:|||||:
Human   555 DKSRKSAKGDKGGKDKKQIQTSPVPVRK---NSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKT 616

  Fly   668 YRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGE 732
            |:|:..|:.|||:||.|.||.:..|.:|||:|.||||||.||||||||||||||:|.:|:|||||
Human   617 YQQKVNRRLQLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGE 681

  Fly   733 VTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVM 797
            |.|..|:|| :.|||||||||.|||.|||||||||||||||||||.|||||||||||||:|||||
Human   682 VCLACKVDT-HALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVM 745

  Fly   798 DYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDF 862
            |||||||:|||||::.:|.|.||||||||:|.|::||||||||||||||||||||.|||||||||
Human   746 DYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDF 810

  Fly   863 GLCTGFRWTHNSKYYQENGNHSRQDSMEP---WEEYS--ENGPKPTVLERRRMRDHQRVLAHSLV 922
            ||||||||||||||||: |:|.|||||||   |::.|  ..|.:...||:|..:.|||.||||||
Human   811 GLCTGFRWTHNSKYYQK-GSHVRQDSMEPSDLWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLV 874

  Fly   923 GTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAE 987
            |||||||||||.|.|||||||:|||||||:|||||||||||.:|.|||.||||||.|||||.|.:
Human   875 GTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKVINWENTLHIPAQVK 939

  Fly   988 LSREATDLIRRLCASADKRLGKS-VDEVKSHDFFKGIDF-ADMRKQKAPYIPEIKHPTDTSNFDP 1050
            ||.||.|||.:||.|||.|||:: .|::|:|.||..||| :|:|||.|||:|.|.||.|||||||
Human   940 LSPEARDLITKLCCSADHRLGRNGADDLKAHPFFSAIDFSSDIRKQPAPYVPTISHPMDTSNFDP 1004

  Fly  1051 VDPEKLRSNDSTMSSGDDVD-----QNDRTFHGFFEFTFRRFFDDKQPP---------------- 1094
            || |:...||::..|....|     .|....|.|:||||||||||...|                
Human  1005 VD-EESPWNDASEGSTKAWDTLTSPNNKHPEHAFYEFTFRRFFDDNGYPFRCPKPSGAEASQAES 1068

  Fly  1095 ---------DMTDDQAPVYV 1105
                     |.|:...||||
Human  1069 SDLESSDLVDQTEGCQPVYV 1088

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 262/373 (70%)
S_TKc 719..1020 CDD:214567 229/307 (75%)
LATS2NP_055387.2 UBA_LATS2 101..141 CDD:270581 6/40 (15%)
PPxY motif 515..518 3/3 (100%)
STKc_LATS2 666..1046 CDD:173715 270/383 (70%)
S_TKc 668..973 CDD:214567 229/307 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0608
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 699 1.000 Inparanoid score I664
Isobase 1 0.950 0 Normalized mean entropy S1496
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoFinder 1 1.000 FOG0002438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126822
Panther 1 1.100 LDO PTHR24356
Phylome 1 0.910 0.923 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.