DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and tlk-1

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_871642.2 Gene:tlk-1 WormBaseID:WBGene00006579 Length:965 Species:Caenorhabditis elegans

Alignment Length:1022 Identity:231/1023 (23%)
Similarity:353/1023 (35%) Gaps:377/1023 (37%)


  Fly   273 GGGSGAVVEPPPPYLIQGGAGGAAPPPPPPSYTASMQSRQSPT-QSQQSDYRKSP-----SSGIY 331
            ||||.:            |.|..:.......:....|::..|| ||..|....:|     ..|..
 Worm    12 GGGSSS------------GGGERSFVLEQKMFNTGPQNKALPTVQSSGSSSNHAPIVGESPLGTV 64

  Fly   332 SATSA-------GSPSPITVSLPPAPLAKPQPRVYQARSQQPIIMQSVK-----STQVQKPVLQT 384
            |:|.|       |:.:.::..:..|....||...:.:.|   ::||.|.     :|:.....:|.
 Worm    65 SSTMATGDTGRVGNVTYMSSGMLGATQFMPQNSSHPSTS---VMMQQVPPQNGGATRSSPTEMQQ 126

  Fly   385 AVAPQSPSSASAS--NSPVHVLAAPPSYPQKSAAVVQQQQQAAAAAHQQQ-----HQHQQSKPPT 442
            .:...|..|....  ||.||.:     :|.:..  :|||||    .||||     |.|||     
 Worm   127 CMQAMSEDSIEMRDYNSGVHHM-----HPHQMQ--MQQQQQ----HHQQQYNMSYHNHQQ----- 175

  Fly   443 PTTPPLVGLNSKPNCLEPPSYAKSMQAKAATVVQQQQQQQQQQQQVQQQ---QVQQQQQQQQQQL 504
                                     |.:.....|||||.||||.|..|.   |:||||||.|||.
 Worm   176 -------------------------QMQQMHYHQQQQQYQQQQAQHHQMYAPQIQQQQQQPQQQS 215

  Fly   505 QALRVLQAQ---------------------AQRERDQR--------------ERDQRERER---- 530
            |.....|.|                     :.||.:|.              ..|::.|:|    
 Worm   216 QQQSAQQPQQSSAALQHVNESSNLSSAGSISDREPEQHGGTPQRPTAPQSSTATDKKTRKRRKAG 280

  Fly   531 ---DQQ----------------KLANGN----------------PGRQMLPPPPYQSNNNN--NS 558
               ||.                ::|:||                |.||    |..|.|.:|  :|
 Worm   281 PTEDQATPKQERKITEFMKVGGEVASGNSVARCLLTEYHQNQGSPKRQ----PAVQQNGSNSYDS 341

  Fly   559 EIKPPSCNNNNIQISNSNLAT---------TP-PIPPAKYNNNSSNTGANSSGGSNGSTG----- 608
            :.:.|..|.:.:|.|...:||         || |.....|:::|::....|..|....:|     
 Worm   342 QQQQPQMNQHEMQNSYWGVATPSLGVNNRGTPTPTQQQHYSSDSNSNSNQSPPGQGNQSGRMVRT 406

  Fly   609 ----TTASSSTSCKKIKHASPIP----------------------ERKKISKEKEE--------- 638
                |...||.|....::|..:.                      ||:|....||.         
 Worm   407 IDEETQTDSSLSQANPQNADEVAKMNRIIEDHRRQIEELNSKNSLERRKNEASKETIKRLLIDKN 471

  Fly   639 --ERKEFRIRQY--SPQ--AFK------FFMEQHIE-----NVIKSYRQRTYRKNQ------LEK 680
              |||..|.:..  ||:  .||      .|.:|.::     .:.|...|....:|:      |.|
 Worm   472 QIERKALRDKTAADSPRIGCFKTTRTGDSFRDQWVDGWAFAEMDKKTEQINAERNEIASASALLK 536

  Fly   681 EMHKVGL---------------------------------------------------------- 687
            :...:|:                                                          
 Worm   537 KRKPLGIGKEPKRPQAVNSQNDSNGMQPSTSSNTNGDDAIFRRPEEPKEIQYQEYIELDEIYKLR 601

  Fly   688 -----PDQTQIEMRK-MLNQKESNYIR-LKRAKMDKS-----------MFVKLKPIGVGAFGEVT 734
                 .::|.:.|.| .|.:::.:::| ||||..:.:           .::.|..:|.|.|.||.
 Worm   602 REHLRKEETDLSMEKERLEKEKQHHVRELKRASNESASQFNDHRLLHKRYLMLNLLGKGGFSEVW 666

  Fly   735 LVSKIDTSNHL-----YAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLY 794
            ....|:.:.::     :..|..::..  |.|.|.|...|:||....|:..:|| .|.....||..
 Worm   667 KAFDIEENRYVACKIHHVNKDWKEEK--KANYVKHAMREKDIHKSLDHCRIVK-QYDLLTIDNHS 728

  Fly   795 F--VMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMG--FIHRDIKPDNILID--- 852
            |  |::|:||.||...|.:.....|:.||..|.:|..|:..:::..  .||.|:||.|||::   
 Worm   729 FCTVLEYVPGNDLDFYLKQNRSISEKEARSIIMQVVSALVYLNEKSTPIIHYDLKPANILLESGN 793

  Fly   853 RDGHIKLTDFGLCTGFRWTHNSKYYQ-ENGNHSRQDSMEPWEEYSENGPKPTVLERRRMRDHQRV 916
            ..|.||:|||||         ||..: |:.:|                            |....
 Worm   794 TSGAIKITDFGL---------SKIMEGESDDH----------------------------DLGIE 821

  Fly   917 LAHSLVGTPNYIAPE--VLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWE-- 977
            |.....||..|:.||  ::.....|...|.||:|||.|:.:.|:.||  .:.| ||||::.:.  
 Worm   822 LTSQFAGTYWYLPPETFIVPPPKITCKVDVWSIGVIFYQCIYGKKPF--GNDL-TQQKILEYNTI 883

  Fly   978 ---KTLHIPPQAELSREATDLIRRLCASADKRLGKSVDEVKSHDFFK 1021
               :.:..|.:.::|..|.|.||| |....|.....|.|:..|:.|:
 Worm   884 INAREVSFPSKPQVSSAAQDFIRR-CLQYRKEDRADVFELAKHELFR 929

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 91/337 (27%)
S_TKc 719..1020 CDD:214567 90/321 (28%)
tlk-1NP_871642.2 STKc_TLK 650..926 CDD:270892 90/320 (28%)
S_TKc 651..928 CDD:214567 90/321 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.