DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and Stk38

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_006523448.1 Gene:Stk38 MGIID:2442572 Length:549 Species:Mus musculus

Alignment Length:593 Identity:223/594 (38%)
Similarity:322/594 (54%) Gaps:100/594 (17%)


  Fly   533 QKLANGNPGRQMLPPP--------------------PYQSNNNNNSEIKPPSCNNNNIQISNSNL 577
            :.|:.|.|..|....|                    |..|...:.:..:.|:|...:.....|.|
Mouse     2 RSLSRGGPSPQSEGVPGEPWPLRAAVFSGSWGSSFCPVLSRIGSCAHSESPACRGRSGAARTSRL 66

  Fly   578 ---------ATTPPIPPAKYNNNSSNTGANSSGGSNGSTGTTASSSTSCKKIKHASPIPERKKIS 633
                     |:.||                      ||.....:.||.|..:.:.:  .||..::
Mouse    67 RRLCSRRPRASLPP----------------------GSAAMAMTGSTPCSSMSNHT--KERVTMT 107

  Fly   634 KEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKM 698
                                |..:|....|:|..:.:|..|:.:|||.|.:.||.|:.:...|..
Mouse   108 --------------------KVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSA 152

  Fly   699 LNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVA 763
            ..:||:.::||||.::....|..||.||.||||||.||.|.|| .|:||||.|||||:|::.||.
Mouse   153 HARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDT-GHVYAMKILRKADMLEKEQVG 216

  Fly   764 HVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVT 828
            |::||||||.|||:.||||::||||||.|||.:|:::||||:|:||:|.....||..:|||||..
Mouse   217 HIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETV 281

  Fly   829 CAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHS--------R 885
            .|:||:|::|||||||||||:|:|..||:||:|||||||.:..|.:::|: |.|||        .
Mouse   282 LAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYR-NLNHSLPSDFTFQN 345

  Fly   886 QDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVI 950
            .:|....|.:..|               :|.||.|.||||:||||||..::||.:|||:||:|||
Mouse   346 MNSKRKAETWKRN---------------RRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVI 395

  Fly   951 LYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLG-KSVDEV 1014
            :||||:|.|||.:.:|.||.:||:||::||..||:..:|.:|..||.|.|...:.|:| ..|:|:
Mouse   396 MYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPVSEKAKGLILRFCCEWEHRIGAPGVEEI 460

  Fly  1015 KSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDSTMSSGDDVDQNDRTFHGF 1079
            |::.||:|:|:..:|::.|....|||...||||||......:.....|.||..:.|..::.: .|
Mouse   461 KNNLFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVTTSSHPETDYKNKDW-VF 524

  Fly  1080 FEFTFRRF 1087
            ..:|::||
Mouse   525 INYTYKRF 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 178/370 (48%)
S_TKc 719..1020 CDD:214567 160/310 (52%)
Stk38XP_006523448.1 STKc_NDR1 171..546 CDD:270777 182/381 (48%)
S_TKc 173..466 CDD:214567 160/310 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126822
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.