DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wts and lats2

Sequence 1:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster
Sequence 2:XP_012811719.1 Gene:lats2 XenbaseID:XB-GENE-994907 Length:1158 Species:Xenopus tropicalis

Alignment Length:1203 Identity:460/1204 (38%)
Similarity:583/1204 (48%) Gaps:299/1204 (25%)


  Fly    14 DKYTAEALESIKQDLTRFEVQNNHRNNQN------------------YTPLRYTAT--------- 51
            |....:.:..|||......:.|.|.|.:.                  |..::.|.|         
 Frog   144 DPRNEQIVRVIKQTSPVHVLWNPHSNRERSISSPGGSVAVSLFICCCYEDIQQTHTVGKVTPPNS 208

  Fly    52 -------NGRNDALTPDYHHAKQ-PMEPPPSASPAPDVV--IP----------PPPAIVGQPGAG 96
                   .|.|:..:| ||.... ..|.|..|:...:|:  :|          |.||.:..|...
 Frog   209 VSHRANFEGSNETFSP-YHPVNNAAYEGPGFAAEGANVLSEVPRQYMDYLLSSPQPATLNGPSQR 272

  Fly    97 SISVSGVGVGVVGVANGRVPKMMTALMPNKLIRKPSIERDTASSHYLRCSPALDSGAGSSRSDSP 161
            .:.       |||..|..|.......:.|   .:.::......||.   ||.|......: |.||
 Frog   273 PLP-------VVGAHNSPVSHQQKGYVTN---AESAVINYVIGSHN---SPGLPIQTPHA-SSSP 323

  Fly   162 HSHHTHQPSSRTVGNPGGNGGFSPSPSGFSEVAPPAPPPRNPTACSAATPPPPVPPTSQAYVKRR 226
            |....|.   ...|:|.|                                          |..:|
 Frog   324 HYSRQHM---MVQGDPMG------------------------------------------YSVQR 343

  Fly   227 SPALNNRPP-----AIAPPTQRGNSPVITQNGLKNPQQQLTQQLKSLNLYPGGGSGAVVEPPPPY 286
            :|:..|:..     ...|.|..|::.....:||..|.....|                       
 Frog   344 TPSFQNKMQQDGGYVNIPQTSPGHAYTQAPSGLYMPHTHHKQ----------------------- 385

  Fly   287 LIQGGAGGAAPPPPPPSYTASMQSRQSPTQSQQSD--------YRKSPSSGIYSATSAGSPS-PI 342
                        ..|||:...:.||.||..::.||        .|.|.:..:|...:|...| |.
 Frog   386 ------------TSPPSHQMHVISRGSPYGNEFSDTPQALLTPSRNSLNMDLYDIGNAWQNSQPC 438

  Fly   343 TVSLP-PAPLAKPQPRV-YQARSQQPIIMQSVKSTQVQKPVLQTAVAPQSP-SSASASNSPVHVL 404
            ..||. |...:.|:..| ::..||.|....|..:.|.||.|:.....|..| ||.:|.|:...|.
 Frog   439 RDSLQGPGLDSSPRQHVSFRPDSQVPSRTNSFNNHQQQKQVVMRQTPPNKPDSSMTAPNTVTTVT 503

  Fly   405 AAPPSYPQKSAAVVQQQQQAAAAAHQQQHQHQQSKPPTPTTPPLVGLNSKPNCLEPPSYAKSMQA 469
            :.....|.||..|.:.:.|.|                       ||          ||:...:.|
 Frog   504 STHILQPVKSMRVARPEPQTA-----------------------VG----------PSHPSWLAA 535

  Fly   470 KAATVVQQQQQQQQQQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQK 534
            :|              |:::.|:|:..:........|...........:|.|             
 Frog   536 QA--------------QKLETQKVEMVEPHTSSMGAANAYGMDVGYGNQDMR------------- 573

  Fly   535 LANGNPGRQMLPPPPYQ-----SNNNNNSEIKPPSCN--NNNIQISNSNLATTPPIPPAKYNNNS 592
                      .|||||.     .||....|:. ..|.  :.|:::|.:     .|..|....|..
 Frog   574 ----------FPPPPYPKHLLLQNNPEQHELN-ALCKGMDQNLRVSEN-----VPCGPVDEANGE 622

  Fly   593 SNTGANSSGGSNGSTGTTASSSTSCKKIKHASPIPERKKISKEKEEERKEFRIRQYSPQAFKFFM 657
            ......|      .|.....|....|:|: .||:|.||   ..::||::|.||:.|||.|:||:|
 Frog   623 PKPSKVS------KTPKVVKSGKDKKQIQ-TSPVPVRK---NSRDEEKRESRIKSYSPFAYKFYM 677

  Fly   658 EQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKL 722
            |||:|||:|:|:|:..|:.|||:||.:.||.:..|.:|||:|.||||||.||||||||||:|||:
 Frog   678 EQHVENVLKTYQQKINRRLQLEQEMAEAGLCEAIQEQMRKILYQKESNYNRLKRAKMDKSLFVKI 742

  Fly   723 KPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSF 787
            |.:|:||||||.|.||:|| ..|||||||||.|||.|||||||||||||||||||.|||||||||
 Frog   743 KTLGIGAFGEVCLASKVDT-KALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSF 806

  Fly   788 QDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILID 852
            ||||:||||||||||||:|||||::.:|.|.||||||||:|.|::||||||||||||||||||||
 Frog   807 QDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILID 871

  Fly   853 RDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEP---WEEYS--ENGPKPTVLERRRMRD 912
            .|||||||||||||||||||||||||: |||:|||||||   |::.|  ..|.:...||:|..|.
 Frog   872 LDGHIKLTDFGLCTGFRWTHNSKYYQK-GNHARQDSMEPSELWDDVSNCRCGDRLKTLEQRAKRQ 935

  Fly   913 HQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWE 977
            |.|.|||||||||||||||||.|.|||||||:|||||||:|||||||||||::|.|||.|||:||
 Frog   936 HHRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQPPFLASNPTETQLKVIHWE 1000

  Fly   978 KTLHIPPQAELSREATDLIRRLCASADKRLGKS-VDEVKSHDFFKGIDF-ADMRKQKAPYIPEIK 1040
            .|||||.|..||.|||:||..||..|:.|||:: .||:|:|.||..:|| :|:|.|.|||:|:|.
 Frog  1001 NTLHIPSQINLSPEATNLITALCCGAEDRLGRNGPDEIKAHPFFISMDFSSDIRHQPAPYVPKIS 1065

  Fly  1041 HPTDTSNFDPVDPEK--LRSNDST------MSSGDDVDQNDRTFHGFFEFTFRRFFDDKQPP--- 1094
            ||.||||||||:.|.  ..|.|||      ||||     |..|.|.|:||||||||||...|   
 Frog  1066 HPMDTSNFDPVEEENPCNDSGDSTVTWDTLMSSG-----NKHTEHAFYEFTFRRFFDDHGYPFRY 1125

  Fly  1095 -----------DMTDDQ-----------APVYV 1105
                       :.|:::           .||||
 Frog  1126 PKPSKLETSSCEETEEEDKNASRESEGCQPVYV 1158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 263/376 (70%)
S_TKc 719..1020 CDD:214567 229/307 (75%)
lats2XP_012811719.1 UBA_LATS2 102..142 CDD:270581
PKc_like 737..1116 CDD:304357 271/386 (70%)
S_TKc 739..1044 CDD:214567 229/307 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0608
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D759391at2759
OrthoFinder 1 1.000 FOG0002438
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.