DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15543 and ak9

Sequence 1:NP_001287617.1 Gene:CG15543 FlyBaseID:FBgn0039799 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_685909.5 Gene:ak9 ZFINID:ZDB-GENE-041014-337 Length:1762 Species:Danio rerio

Alignment Length:153 Identity:46/154 (30%)
Similarity:76/154 (49%) Gaps:30/154 (19%)


  Fly    91 VLHGKPGSGRRSLAYVLAQRWN-LLILDADVLAYHSINKQDQDEP-SRLLQE--AIEKDCVYKRS 151
            ::.||||.|:.:||..:|:.|| :||.|.|||..|..|:.||.:. .|:|.|  |:.::.:.   
Zfish    34 IIIGKPGVGKSTLAKKIAKTWNCILIDDTDVLNNHINNETDQGKQLFRILAEGKAVPEEMMV--- 95

  Fly   152 QAVGNLIENRLLQEDALHRGWILINYPNNKCEAEELFEGFTVPPNRFVFLQIDERLARMRILLNS 216
                |||.:||...|..|.|::|...|:   .:||             :::|.|::..::.|  .
Zfish    96 ----NLIVDRLKSPDIKHYGYVLACLPS---ISEE-------------YMKIQEQIDLIKTL--K 138

  Fly   217 YSPGPQAHVSFVDRQMAQFRKSE 239
            .||....::...||.:.: |.||
Zfish   139 MSPDFIINIKCADRDLIR-RLSE 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15543NP_001287617.1 NK 89..>213 CDD:302627 38/126 (30%)
ak9XP_685909.5 adk 33..280 CDD:273569 46/154 (30%)
ADK 33..276 CDD:238713 46/154 (30%)
AAA_17 394..504 CDD:289950
DUF3508 <717..804 CDD:288841
Ribosomal_L24e_L24 <775..808 CDD:294589
NK 816..>983 CDD:302627
Adk 1258..1445 CDD:223637
ADK 1258..1432 CDD:238713
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23359
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.