DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15543 and Adk2

Sequence 1:NP_001287617.1 Gene:CG15543 FlyBaseID:FBgn0039799 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_523836.2 Gene:Adk2 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster

Alignment Length:203 Identity:45/204 (22%)
Similarity:77/204 (38%) Gaps:43/204 (21%)


  Fly    83 PRSFYHRIVLHGKPGSGRRSLAYVLAQRWNLLILD-ADVLAYHSINKQDQDEPSRLLQEAIEKDC 146
            |.:.....:|.|.||||:.:.|.:|.:::.:..|. .|:|      :.:....|:|..|      
  Fly    14 PENIGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDML------RAEISSGSKLGAE------ 66

  Fly   147 VYKRSQAVGNLIENRL--------LQEDALHRGWILINYPNNKCEAEELFEGFTVPPNR------ 197
             .|:....|.|:.:.|        |.:.....|::|..:|....:||:|   .|:...|      
  Fly    67 -LKKVMDAGKLVSDDLVVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKL---DTLLDKRKTNLDA 127

  Fly   198 FVFLQIDERLARMRI---LLNSYSPGPQAHVSFV--DRQMAQFRKSEPAL------SSYLSQRRE 251
            .:...||:.|...||   |::..| |...|..|.  .:.|......||.:      :..|.:|.|
  Fly   128 VIEFAIDDSLLVRRITGRLIHQAS-GRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLE 191

  Fly   252 VVYVDASP 259
            ..:....|
  Fly   192 AYHKQTKP 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15543NP_001287617.1 NK 89..>213 CDD:302627 32/142 (23%)
Adk2NP_523836.2 adk 20..233 CDD:234711 44/198 (22%)
ADK 20..222 CDD:238713 44/198 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23359
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.