DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15543 and Ak8

Sequence 1:NP_001287617.1 Gene:CG15543 FlyBaseID:FBgn0039799 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001004266.1 Gene:Ak8 RGDID:1303144 Length:479 Species:Rattus norvegicus

Alignment Length:352 Identity:77/353 (22%)
Similarity:132/353 (37%) Gaps:117/353 (33%)


  Fly     1 MSSPTDFDRSMLVE--------------YSAAFMYYIEKHKLMEVMSRL-----LAEISVADGVT 46
            :|:|.    |:|:|              |...|.:..|    :|:.:||     ::||..|..:.
  Rat   164 LSAPD----SVLIERNVGKRIDPVTGEIYHTTFDWPPE----LEIQNRLIQPEGISEIDTAKKLL 220

  Fly    47 DVRRWMGENITRIGVEIYTK----------SMDAFHRGV----RGDFYQLPRSFYHRIVLHGKPG 97
            :..|    :|.|| :..|.|          .:|.|::.:    .|.....|  |..:::|.|..|
  Rat   221 EYHR----HIIRI-LPSYPKILKTISSDQPCVDVFYQALTYVQSGHRCNAP--FTPKVLLCGPMG 278

  Fly    98 SGRRSLAYVLAQRWNLLILDADVLAYHSINKQDQDEPSRLLQEAIEKDCVYKRSQAVGNLIE--- 159
            .|::..|.:|:|::.|:.:..                .:||:||:..:      .::|:|||   
  Rat   279 CGKKLQAALLSQKYGLVNISC----------------GQLLKEAMAAE------SSLGDLIEPFF 321

  Fly   160 ----------------NRLLQEDALHRGWILINYPNNKCEAEELFEGFTVPPNRFVFLQI--DER 206
                            .||.|:|.:.:||:|..:|.:..:| .|.......|||..||.:  |..
  Rat   322 EKRMTVPDSIITRVLTERLKQQDCIQKGWVLHGFPRDLDQA-RLLNSMGYSPNRVFFLNVPLDSI 385

  Fly   207 LARMRILLNS----------YSPGPQAHV------------SFVDRQMAQFRKSEPALSSYLSQR 249
            |.|:.:....          |.|.|...|            .::..|...|.::...|..|. .|
  Rat   386 LERLTLRRTDPVTGERFHLMYKPPPTIEVQARLLQNPKDSEEYIKLQTDLFYRNSGDLEQYY-DR 449

  Fly   250 REVVYVDASP--CFEQVKCGIISELTK 274
            ..:|..|..|  .||.::.|||:.|.:
  Rat   450 AIIVNGDQDPYTVFEYIESGIINPLPR 476

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15543NP_001287617.1 NK 89..>213 CDD:302627 34/145 (23%)
Ak8NP_001004266.1 Adenylate kinase 1. {ECO:0000250|UniProtKB:Q96MA6} 58..258 22/107 (21%)
adk 59..258 CDD:273569 22/107 (21%)
ADK 59..249 CDD:238713 21/98 (21%)
NMPbind 1. {ECO:0000250|UniProtKB:P69441} 87..113
LID 1. {ECO:0000250|UniProtKB:P69441} 177..206 6/33 (18%)
Adenylate kinase 2. {ECO:0000250|UniProtKB:Q96MA6} 269..471 50/226 (22%)
adk 270..468 CDD:273569 48/222 (22%)
ADK 270..462 CDD:238713 46/216 (21%)
NMPbind 2. {ECO:0000250|UniProtKB:P69441} 298..327 8/51 (16%)
LID 2. {ECO:0000250|UniProtKB:P69441} 391..424 4/33 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23359
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.