DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15543 and Ak4

Sequence 1:NP_001287617.1 Gene:CG15543 FlyBaseID:FBgn0039799 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_058831.1 Gene:Ak4 RGDID:2078 Length:223 Species:Rattus norvegicus

Alignment Length:217 Identity:52/218 (24%)
Similarity:90/218 (41%) Gaps:44/218 (20%)


  Fly    89 RIVLHGKPGSGRRSLAYVLAQRWNLLILDADVLAYHSINKQDQDEPSRLLQEAIEKDCVYKRSQA 153
            |.|:.|.||||:.::...:||.:.|..|.:..|...  |.:...|...:.::.:||..:.. ...
  Rat     7 RAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRE--NLKTNTEVGDVAKQYLEKGLLVP-DHV 68

  Fly   154 VGNLIENRLLQEDALHRGWILINYPNNKCEAE--------ELFEGFTVPPNRFVFLQIDERLARM 210
            :..|:.:.|....|.|  |:|..:|....:||        :|.....:|     |..:.:||:|.
  Rat    69 ITRLMMSELETRSAQH--WLLDGFPRTLVQAEALDRICDVDLVISLNIP-----FETLKDRLSRR 126

  Fly   211 -------RILLNSYSPGPQAHVSFVD----RQMAQFRKSEP-ALSSYLSQRREVVYVDASPCFEQ 263
                   |:....::| ||  |..||    ..:.|....:| ||::.|.:.::.    |.|..|.
  Rat   127 WIHPSSGRVYNLDFNP-PQ--VLGVDDITGEPLVQQEDDKPEALAARLRRYKDA----AKPVIEL 184

  Fly   264 VKC-GIISELTKT------PYV 278
            .|. |::.:.:.|      |||
  Rat   185 YKSRGVLHQFSGTETNRIWPYV 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15543NP_001287617.1 NK 89..>213 CDD:302627 32/139 (23%)
Ak4NP_058831.1 adk 7..211 CDD:273569 52/218 (24%)
ADK 7..199 CDD:238713 49/209 (23%)
NMPbind. {ECO:0000255|HAMAP-Rule:MF_03170} 35..64 5/31 (16%)
LID. {ECO:0000255|HAMAP-Rule:MF_03170} 125..162 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23359
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.