DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and AT3G23310

DIOPT Version :8

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_188973.2 Gene:AT3G23310 / 821911 AraportID:AT3G23310 Length:568 Species:Arabidopsis thaliana

Alignment Length:389 Identity:110/390 (28%)
Similarity:187/390 (48%) Gaps:80/390 (21%)


  Fly    11 NSKEDYNVI--LDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREKSGKNYYAA 73
            :.:|..|::  |:....|:..|..|:     ...:::....::|.|:||.|.:.|||:..|.||.
plant    89 SEEEQKNLLKDLEKKETEYMRRQRHK-----MGTDDFEPLTMIGKGAFGEVRICREKTTGNVYAM 148

  Fly    74 KMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVR 138
            |.:.|.:::|..||.||..|:::|.......::.|..|.:..:|||||:..:.||::.:...|..
plant   149 KKLKKSEMLRRGQVEHVKAERNLLAEVDSNCIVKLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKD 213

  Fly   139 KFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTK------------ 191
            ...|..||||..:..||:|.:||.:.::||:||:|:|||:.|::|::|||..|            
plant   214 TLTEDEARFYVGETVLAIESIHKHNYIHRDIKPDNLLLDRSGHMKLSDFGLCKPLDCSILQEKDF 278

  Fly   192 ----------RVDGRT-------------------------STLCGTPEYLAPEIVQLRPYNKSV 221
                      :.|||.                         ||: |||:|:|||::..:.|....
plant   279 VVAHNLSGALQSDGRPVAPRRTRSQMEQLQNWQRNRRMLAYSTV-GTPDYIAPEVLLKKGYGMEC 342

  Fly   222 DWWAFGILVYEFVAGRSPFAIHNRDVILMYS----KIC--ICDYKMPSYFTSQLRSLVES----- 275
            |||:.|.::||.:.|..||          ||    ..|  |.::|....|..::|...|:     
plant   343 DWWSLGAIMYEMLVGFPPF----------YSDEPMTTCRKIVNWKNYLKFPDEVRLSPEAKDLIC 397

  Fly   276 LMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSNFENFEFKDR 339
            .:..:..:|:|..  |::::|.||||.||:|..:  .::.|.:.|.::...|..|||.||..|:
plant   398 RLLCNVEQRIGTK--GANEIKEHPWFSGVEWEKL--YQMKAAFIPQVNDELDTQNFEKFEETDK 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 101/349 (29%)
AT3G23310NP_188973.2 STKc_NDR_like 118..485 CDD:270750 104/356 (29%)
S_TKc 120..421 CDD:214567 91/314 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.714 Consistency score
10.910

Return to query results.
Submit another query.