DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and F47F2.1

DIOPT Version :8

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_508671.2 Gene:F47F2.1 / 180673 WormBaseID:WBGene00018569 Length:398 Species:Caenorhabditis elegans

Alignment Length:317 Identity:131/318 (41%)
Similarity:194/318 (61%) Gaps:8/318 (3%)


  Fly    40 TNLENYITRAVLGNGSFGTVMLVREKSGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPF 104
            :.||..||   :|.|:||.|.|.|:|....:||.|:::...:|.::|..||||||.||...:.||
 Worm    88 SQLERIIT---IGKGTFGRVELARDKITGAHYALKVLNIRRVVDMRQTQHVHNEKRVLLQLKHPF 149

  Fly   105 LIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDL 169
            ::.:..|.|..::||:|:..|.|||:|||.|..|.|:...|||||:::..||||:|.:.::||||
 Worm   150 IVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMARFYASEIVCALEYIHSLGIVYRDL 214

  Fly   170 KPENILLDQRGYIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFV 234
            ||||::|.:.|:||:.||||.|.:..||.|:||||:|||||.:....:||.|||||.|||:||.:
 Worm   215 KPENLMLSKEGHIKMADFGFAKELRDRTYTICGTPDYLAPESLARTGHNKGVDWWALGILIYEMM 279

  Fly   235 AGRSPFAIHNRDVILMYSKICICDYKMPSYFTSQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHP 299
            .|:.||  ..:....:|..|.....|.|..|....:.||:.|::||.::|:|...:|:.|||.|.
 Worm   280 VGKPPF--RGKTTSEIYDAIIEHKLKFPRSFNLAAKDLVKKLLEVDRTQRIGCMKNGTQDVKDHK 342

  Fly   300 WFQGVDWFGILNQEVTAPYQPTISGAEDLSNFENFEFKDRYKSRI--NRHPELFANF 354
            ||:.|:|...|:..|..|..||:....|..||:::| :|.....:  .|..:|||.:
 Worm   343 WFEKVNWDDTLHLRVEPPIVPTLYHPGDTGNFDDYE-EDTTGGPLCSQRDRDLFAEW 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 124/291 (43%)
F47F2.1NP_508671.2 PTZ00263 80..379 CDD:140289 126/297 (42%)
PKc_like 88..379 CDD:304357 126/297 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D277423at33208
OrthoFinder 1 1.000 FOG0000314
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.