DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and LOC102547029

DIOPT Version :8

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_017445956.1 Gene:LOC102547029 / 102547029 RGDID:7608714 Length:547 Species:Rattus norvegicus

Alignment Length:329 Identity:155/330 (47%)
Similarity:216/330 (65%) Gaps:12/330 (4%)


  Fly     7 QYVFNSKEDYNVILDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREKSGKNYY 71
            :::..:|||           |..:|.:...| ...||::..:..||.||||.||||:.|:...||
  Rat   212 EFLAKAKED-----------FLRKWENPPPS-NAGLEDFERKKTLGTGSFGRVMLVKHKATAQYY 264

  Fly    72 AAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRR 136
            |.|::.|:.:|:|||:.|..|||.:|.|..||||:.|..|.|....||:::..|.|||:||:.||
  Rat   265 AMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRR 329

  Fly   137 VRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVDGRTSTLC 201
            :.:|:|.||||||||:.|..||:|.:.|:||||||||:|:|.:|||::|||||.|||.|||.|||
  Rat   330 IGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLC 394

  Fly   202 GTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKMPSYFT 266
            ||||||||:|:..:.|||:|||||.|:|:||..||..|........|.:|.||.....:.||:|:
  Rat   395 GTPEYLAPKIILSKGYNKAVDWWALGVLIYEMAAGYPPPPFFADQPIQIYEKIVSGKVRFPSHFS 459

  Fly   267 SQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSNF 331
            |.|:.|:.:|:|||.:||.||..:|.||:|:|.||...||..|..::|.||:.|...|:.|.|||
  Rat   460 SDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNF 524

  Fly   332 ENFE 335
            :::|
  Rat   525 DDYE 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 147/291 (51%)
LOC102547029XP_017445956.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D277423at33208
OrthoFinder 1 1.000 FOG0000314
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.