DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tmod and unc-94

Sequence 1:NP_001247372.1 Gene:tmod FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_491735.1 Gene:unc-94 WormBaseID:WBGene00006823 Length:401 Species:Caenorhabditis elegans

Alignment Length:367 Identity:143/368 (39%)
Similarity:225/368 (61%) Gaps:19/368 (5%)


  Fly    87 PAKLYGKDLSEYDDVDVESLLAQLSPEEITILAKEVDPDDNFLPPDQRNSYECTKEATGPLNRKQ 151
            |:|:|.|.|.   |.|:|.||:.||.:|:..|..:.|||::.|||.||...:..||.|||..|..
 Worm    41 PSKVYNKGLK---DNDIEGLLSSLSIDELEDLNNDFDPDNSMLPPSQRCRDQTDKEPTGPYKRDN 102

  Fly   152 LIEHINKQAIETPDQPEFEPFVQGKVRGKKWVPPPRDARDIEAEEQ------IAIDMG---EEYE 207
            |::.:..:|....|..:..|:..|:.|||  |......|:.|..|.      |.||:.   ||.|
 Worm   103 LLKFLEDKAKTEKDWEDVCPYTPGQKRGK--VYDSDSGRNSEEPENGKMEMPIEIDLDDDEEELE 165

  Fly   208 HALNDATQEEIIDLAAILGFHSMMNQDQYHASLLNKGQ--PVGLGWDGITKSTQQKLFPMDPPNN 270
            .||..|.:::::|||.|||.|:::||.||:.:|..|.|  ..|..::||.:|...::.|.:|.|:
 Worm   166 CALVTAPEKDLVDLAGILGMHNVLNQPQYYNALKGKTQDESTGTTFNGIMQSYVPRIVPDEPDND 230

  Fly   271 TDVEESIKRVKDDDSKLIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLA 335
            ||||..|.|:::||:.|.::|:||:|.:|.|::..|..|...::|:|..||.|..::|..|..|.
 Worm   231 TDVESCINRLREDDTDLKEVNINNMKRVSKERIRSLIEAACNSKHIEKFSLANTAISDSEARGLI 295

  Fly   336 AAIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLGNKIEMEITDLVEKN 400
            ..||.|.:|||||||:||::|.::.:|:::.|...:|.||:|.|||.:||||::||::...:|:|
 Worm   296 ELIETSPSLRVLNVESNFLTPELLARLLRSTLVTQSIVEFKADNQRQSVLGNQVEMDMMMAIEEN 360

  Fly   401 SSLLRLGLHLEFNDARHRVAAHLQRNIDRIFRVQKL--KPNL 440
            .||||:|:.....:|||||:..|:||.:|: |:::|  .||:
 Worm   361 ESLLRVGISFASMEARHRVSEALERNYERV-RLRRLGKDPNV 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 55/151 (36%)
LRR_RI <285..421 CDD:238064 57/136 (42%)
unc-94NP_491735.1 Tropomodulin 45..191 CDD:281268 55/151 (36%)
LRR_RI <245..395 CDD:238064 62/151 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131126032
eggNOG 1 0.900 E1_KOG3735
Hieranoid 1 1.000
Homologene 1 1.000 H20701
Inparanoid 1 1.050 253 1.000 Inparanoid score I1953
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1025132at2759
OrthoFinder 1 1.000 FOG0000661
OrthoInspector 1 1.000 T475428
orthoMCL 1 0.900 OOG5_134147
Panther 1 1.100 LDO PTHR10901
Phylome 1 0.910 0.962 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2851
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.