DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9698 and PH4alphaNE3

DIOPT Version :8

Sequence 1:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster

Alignment Length:518 Identity:134/519 (26%)
Similarity:228/519 (44%) Gaps:74/519 (14%)


  Fly    24 EFFSSIHEMTKVFGYEQKMVLHMQKFLSDNQDKLDFLKARLREFENERNEAREWGPSYFESPINK 88
            ||..:......:...:.:::.::..:.....:|...||...:|.....:.|:.....|..:|::.
  Fly    16 EFLDTESAKMDLMQLDVELIDNLMNYAEKIDEKASQLKRLAQELRQPLHSAKGREEEYLGNPLHS 80

  Fly    89 YLLNKRLTVDWQRVENLMATSTGEKPLTRLRKFRNRETMPDKKELEGAIDGLLRLQYVYRLKAKD 153
            :.|.:.:..||:.:|..|....||:.:..||  |....:|.:.:.|.|...:.|:...|.:...|
  Fly    81 FPLIRHMYQDWRYLEEFMKKPVGEEEIQFLR--RKLPELPWQVDTEEASVSIFRIAETYGMMPWD 143

  Fly   154 LARGILDGVDYGTQLNSEHCVDIARLALRDQHPRLAHSWLIEANDRLTGGEKEEQ--------LK 210
            :|.|::|.|.:.:.|.:..|.::|::..:..:.:.|..|:..:..|:    |||.        :.
  Fly   144 MANGLIDNVRFNSTLPALDCFEVAKMYFKWGYFKQALQWITISKARM----KEEYSGVYEVLGMN 204

  Fly   211 PQILALLVQAKKELEDFRGLNDTYQELIGIQSASEEHAKNYETFL-------NALSEKALLNESK 268
            .|.:||| ||:.              |:.:....|.|    |..|       |::|   ||::.|
  Fly   205 RQDVALL-QARC--------------LVELDRRDEAH----EVLLDQPDLADNSIS---LLDQFK 247

  Fly   269 --PILEHAPIPEEGEPVGEFQAYSLTCSGHWRLTPKEQRHLRCGYVTETHPFLWIAPLKAEELFQ 331
              |.......|:.||      .|...|...:...|.:   |.|.|.:.|..||.:||||.||:..
  Fly   248 ANPYEAIDSSPKLGE------GYKRLCRSSFSPNPSK---LHCRYNSTTSAFLILAPLKMEEISL 303

  Fly   332 DPLLVLYHDVIYQSEIDVIRKLTENRLMRATITSHNESVVSNVRTSQFTFIPVTAHKVLSTIDQR 396
            :|.:|:|||::...:|..:..|.|..|....:...|:   :..|:|..|  |: ...:|.::.||
  Fly   304 EPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNK---NEARSSYRT--PL-GGPLLDSLTQR 362

  Fly   397 VADMTNLNMKYAEDHQFANYGIGGHYGQHMDWFYQTTFDAGLVSSPEMGNRIATVLFYLSDVAQG 461
            :.|:|.|.::.........||.|..|..:.|:|.:...:     |...|:|:||.:|||:|...|
  Fly   363 MRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSE-----SKGFGDRMATFMFYLNDAPYG 422

  Fly   462 GGTAFPQLRTLLKPKKYAAAFWHNLHASGVGDVR-----TQHGACPIIAGSKWVQNRWIREND 519
            |.|.||:|...:..::....||:||:    ||..     |.|.|||:..|||||...||.|.|
  Fly   423 GATVFPRLNVKVPAERGKVLFWYNLN----GDTHDMEPTTMHAACPVFHGSKWVMTAWIHEYD 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528 25/131 (19%)
P4Hc 345..516 CDD:214780 54/176 (31%)
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 25/126 (20%)
P4Hc 316..478 CDD:214780 54/177 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146324188
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D192165at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.