DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and P4HA2

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001136071.1 Gene:P4HA2 HGNCID:8547 Length:535 Species:Homo sapiens

Alignment Length:523 Identity:134/524 (26%)
Similarity:234/524 (45%) Gaps:71/524 (14%)


  Fly     8 LW---LLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEE 69
            ||   ||..:..|.|...|.|......:..|:..|.:|:..|::||...|.:|.:|:...:.:|.
Human     3 LWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEA 67

  Fly    70 IHSQ-VDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEES 133
            :.|: ....|.|:.:|:|.:.::||..:.||.||..........|...||.::...|::||...:
Human    68 LTSKSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGA 132

  Fly   134 LNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALEKLP 194
            ...|:.||..|.||..::|.|.:.|.|..:.:|..||..:.|    :.|:.....|:|..|::|.
Human   133 AKALMRLQDTYRLDPGTISRGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLD 197

  Fly   195 SASE-NSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKA 258
            :..| .:|:||         :|:......::.|:|.|||.....||.|.|.::......|..|: 
Human   198 AGEEATTTKSQ---------VLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQ- 252

  Fly   259 MAKKELPKGRGQKSKA---------KKQISKSTEQLLIEEICRG------AKQQVTTGSRFNHCQ 308
            :.::|..|....:::|         ::.:....|:.:.|.:|||      .::|.....|::|  
Human   253 LLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHH-- 315

  Fly   309 LDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEE------EDTK-GV----SY 362
             ...:|.||:.|.:.|.....|:||.::||::.:|...:.::...:      .|.| ||    ||
Human   316 -GNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASY 379

  Fly   363 QSLKLSKLAQKK---LGRISR----LLGL-----EILELDPW--TGRRHGHEHITKLEHSSELKH 413
            :..|.|.|.:..   :.|::|    :.||     |:|::..:  .|:...|...::.:.....||
Human   380 RVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVANYGVGGQYEPHFDFSRNDERDTFKH 444

  Fly   414 ------VARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPV 472
                  ||..:..:.....|||.|||.|..|:...:|:.:.|......|   |.|||:..|.|||
Human   445 LGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSG---EGDYRTRHAACPV 506

  Fly   473 LLG 475
            |:|
Human   507 LVG 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 35/127 (28%)
P4HA2NP_001136071.1 P4Ha_N 26..155 CDD:311993 35/129 (27%)
TPR 207..240 12/42 (29%)
P4Hc 346..519 CDD:214780 43/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.