DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and AT1G20270

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana

Alignment Length:208 Identity:42/209 (20%)
Similarity:74/209 (35%) Gaps:69/209 (33%)


  Fly   324 EPVSSDPYIVLHHDVLTPKESNELLQL----------IDEEEDTKGVSYQSL------------- 365
            |.:|.:|...::|:.|:.:|...|:.|          :|.|   .|.|..|.             
plant    77 EVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSE---TGKSKDSRVRTSSGTFLRRGR 138

  Fly   366 -KLSKLAQKKLGRISRL-----LGLEILELDPWTGRR---HGHEHITKLEHSSELKHVARLMLNL 421
             |:.|..:|::...:.:     .||::|..:  .|::   |....:.:....:..:.:|.:::.|
plant   139 DKIIKTIEKRIADYTFIPADHGEGLQVLHYE--AGQKYEPHYDYFVDEFNTKNGGQRMATMLMYL 201

  Fly   422 QAPGMGGAVVFPQLELAVNV----------------------PR--GSLLHWRTRFAGGSSSEWD 462
            .....||..|||    |.|:                      ||  .:||.|..|    ..:..|
plant   202 SDVEEGGETVFP----AANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMR----PDATLD 258

  Fly   463 YRSGQAICPVLLG 475
            ..|....|||:.|
plant   259 PTSLHGGCPVIRG 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
AT1G20270NP_564109.1 DUF4713 <3..38 CDD:292459
P4Hc 93..281 CDD:214780 37/193 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.