DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and AT5G18900

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana

Alignment Length:164 Identity:35/165 (21%)
Similarity:63/165 (38%) Gaps:49/165 (30%)


  Fly   312 SSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLAQKKLG 376
            ||..:.:.||:::.|||.|...::...||..|.:.::.|          :..|||.|.:|....|
plant    26 SSSSVFVNPSKVKQVSSKPRAFVYEGFLTELECDHMVSL----------AKASLKRSAVADNDSG 80

  Fly   377 R-------------ISR-----LLGLEILELDPWT--GRRHGHE-HITKLEHSSEL--------- 411
            .             ||:     :.|:|. ::..||  .:.:|.: .:.:.||..:.         
plant    81 ESKFSEVRTSSGTFISKGKDPIVSGIED-KISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHD 144

  Fly   412 --------KHVARLMLNLQAPGMGGAVVFPQLEL 437
                    ..:|.:::.|.....||..|||..|:
plant   145 KVNIVRGGHRMATILMYLSNVTKGGETVFPDAEI 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
AT5G18900NP_197391.1 P4Hc 54..244 CDD:214780 26/137 (19%)
ShKT 258..298 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.