DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and AT4G35810

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana

Alignment Length:202 Identity:43/203 (21%)
Similarity:74/203 (36%) Gaps:55/203 (27%)


  Fly   323 LEPVSSDPYIVLHHDVLTPKESNELLQL------------------IDEEEDTKGVSYQSLKLSK 369
            ||.:|.:|...::|:.||.:|...|:.|                  ||....|...::.:....:
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFLNRGHDE 144

  Fly   370 LAQKKLGRISRLL--------GLEILELDPWTGRRHGHEHITKLEHSSELK---HVARLMLNLQA 423
            :.::...|||...        ||::|..:  .|:|:...|....:..:..|   .:|.:::.|..
plant   145 IVEEIENRISDFTFIPPENGEGLQVLHYE--VGQRYEPHHDYFFDEFNVRKGGQRIATVLMYLSD 207

  Fly   424 PGMGGAVVFPQLELAV-NVP-------------------RGSLLHWRTRFAGGSSSEWDYRSGQA 468
            ...||..|||..:..| :||                   |.:||.|..:    ..:..|..|...
plant   208 VDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMK----PDASLDPSSLHG 268

  Fly   469 ICPVLLG 475
            .|||:.|
plant   269 GCPVIKG 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
AT4G35810NP_001320148.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.