DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and P4H2

DIOPT Version :9

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:217 Identity:45/217 - (20%)
Similarity:80/217 - (36%) Gaps:53/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 SSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLAQKKL- 375
            |||..::.||:::.|||.|...::...||..|.:.|:.|..|......|:......|:::..:. 
plant    27 SSPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQVSDVRTS 91

  Fly   376 -------GRISRLLGLEILELDPWT------GR-------RHGHEHITKLEHSSELKHVAR---- 416
                   |:...:.|:|. :|..||      |.       .||.::....::..:..::||    
plant    92 SGTFISKGKDPIVSGIED-KLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDKVNIARGGHR 155

  Fly   417 ---LMLNLQAPGMGGAVVFPQLE---------------------LAVNVPRGSLLHWRTRFAGGS 457
               ::|.|.....||..|||..:                     :||...:|:.|.:........
plant   156 IATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQDAI 220

  Fly   458 SSEWDYRSGQAICPVLLGVQLS 479
            ...:....|   |||:.|.:.|
plant   221 PDPFSLHGG---CPVIEGEKWS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 35/189 (19%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.