DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31371 and P4H2

DIOPT Version :10

Sequence 1:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:217 Identity:45/217 - (20%)
Similarity:80/217 - (36%) Gaps:53/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 SSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLAQKKL- 375
            |||..::.||:::.|||.|...::...||..|.:.|:.|..|......|:......|:::..:. 
plant    27 SSPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQVSDVRTS 91

  Fly   376 -------GRISRLLGLEILELDPWT------GR-------RHGHEHITKLEHSSELKHVAR---- 416
                   |:...:.|:|. :|..||      |.       .||.::....::..:..::||    
plant    92 SGTFISKGKDPIVSGIED-KLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDKVNIARGGHR 155

  Fly   417 ---LMLNLQAPGMGGAVVFPQLE---------------------LAVNVPRGSLLHWRTRFAGGS 457
               ::|.|.....||..|||..:                     :||...:|:.|.:........
plant   156 IATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQDAI 220

  Fly   458 SSEWDYRSGQAICPVLLGVQLS 479
            ...:....|   |||:.|.:.|
plant   221 PDPFSLHGG---CPVIEGEKWS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..158 CDD:462433
P4H2NP_566279.1 PLN00052 37..299 CDD:177683 40/207 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.