DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and P4H13

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana

Alignment Length:89 Identity:21/90 (23%)
Similarity:32/90 (36%) Gaps:23/90 (26%)


  Fly   407 HSSEL-----KHVARLMLNLQAPGMGGAVVFP---------------QLELAVNVPRGSLLHWRT 451
            ||:|.     :.|...:|.|.:...||..:||               .:.|.|...:|..:.:..
plant   174 HSAEYGPLISQRVVTFLLFLSSVEEGGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYN 238

  Fly   452 RFAGGSSSEWDYRSGQAICPVLLG 475
            .|..|:.   |..|....|||:.|
plant   239 LFPNGTI---DQTSLHGSCPVIKG 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 21/90 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.