DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and P4H5

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana

Alignment Length:254 Identity:50/255 (20%)
Similarity:95/255 (37%) Gaps:78/255 (31%)


  Fly   274 AKKQISKSTEQLLIEEICRGAKQQVTTGSRFNHCQLDGSSP-WLLLQPSRLEPVSSDPYIVLHHD 337
            |.:..||:.:   :..|.|  |.:.::|..      :|:.. |       :|.:|.:|..|::|:
plant    48 ANRNSSKTND---LTNIVR--KSETSSGDE------EGNGERW-------VEVISWEPRAVVYHN 94

  Fly   338 VLTPKESNELLQL----------IDEEEDTKGVSYQSLKLS-------------KLAQKKLGRIS 379
            .||.:|...|:.|          :||:  |.|.....::.|             ::.:|::...:
plant    95 FLTNEECEHLISLAKPSMVKSTVVDEK--TGGSKDSRVRTSSGTFLRRGHDEVVEVIEKRISDFT 157

  Fly   380 RL-----LGLEILELDPWTGRR---HGHEHITKLEHSSELKHVARLMLNLQAPGMGGAVVFPQLE 436
            .:     .||::|...  .|::   |....:.:....:..:.:|.:::.|.....||..|||...
plant   158 FIPVENGEGLQVLHYQ--VGQKYEPHYDYFLDEFNTKNGGQRIATVLMYLSDVDDGGETVFPAAR 220

  Fly   437 LAVN-VP-------------------RGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLG 475
            ..:: ||                   |.:||.|..|    ..:..|..|....|||:.|
plant   221 GNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMR----PDASLDPSSLHGGCPVVKG 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
P4H5NP_179363.1 P4Hc 99..285 CDD:214780 34/186 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.