DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and p4htm

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htm ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio

Alignment Length:532 Identity:100/533 (19%)
Similarity:158/533 (30%) Gaps:197/533 (37%)


  Fly     7 VLWLLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIH 71
            ::.::.|.|.|....|:|                 .|...||:...     :....:.:...:..
Zfish    69 IINVIALLLYVHYNNGSN-----------------AISANRDFTSS-----DSSSHKVTGASDAQ 111

  Fly    72 SQVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEESLNH 136
            :..||     |.|.|:|  |.|.|.:..|..||    :.:|.|:                     
Zfish   112 ATADS-----GFPRNMF--LPRIEGIRVGHVQK----VSLVSGK--------------------- 144

  Fly   137 LLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVARKSDFPVARFWLESALEKLPSASENST 201
                  |:|:.:.||...:   |::...:|..:|..|.|              |.:|....|:..
Zfish   145 ------VHEMKTLSLKPLL---FEIPDFLSEEECAVVVR--------------LAQLKGLMESQV 186

  Fly   202 ---ESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKAMAKKE 263
               |.|.|        |:..||:            :.||:...|.:||..|....:|.       
Zfish   187 MVPEGQEE--------LDQQLNL------------SPEEIFNFLDLNQDGQLQPHEIL------- 224

  Fly   264 LPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSRFNHCQLDGSSPWLLLQPSRLEPVSS 328
                  ..|:.:..|..::|.|  :||..|.|           ..|||:.   ||.......:.|
Zfish   225 ------THSRVRDGIWLTSENL--KEIYDGLK-----------ADLDGNG---LLSLEEFGRLRS 267

  Fly   329 DPY--IVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLAQKKLGRISRLLGL--EILEL 389
            |.:  .:|...|       |..||:.....|  ..||.....::.|....|::.|..|  .::||
Zfish   268 DAFQRFLLQRGV-------ERSQLVRNSRHT--WLYQGQGAHQVLQDLRKRVTLLTRLPSSLVEL 323

  Fly   390 -DPWT-------GRRHGHEHITKLEHSSELKHVARLMLNLQAPGM-----------------GGA 429
             :|..       |..|.|.....:...:...| .||..|..:|..                 ||.
Zfish   324 SEPLQVVRYEQGGHYHAHHDSGPVYPETACTH-TRLAANTTSPFQTSCRYITVLFYLNNVQEGGE 387

  Fly   430 VVFPQLE---------------------------LAVNVPRGSLLHWRTRFAGGSS--SEWDYRS 465
            ..||..:                           |.|...:|:.:.|....:.|..  .|.|..|
Zfish   388 TTFPVADNRTYEEASLIQNDVDLLDTRKHCDKGNLRVKPVKGTAVFWYNYLSDGRGWVGEQDEYS 452

  Fly   466 GQAICPVLLGVQ 477
            ....|.|..|.:
Zfish   453 LHGGCVVTQGTK 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 21/126 (17%)
p4htmXP_001340234.2 EF-hand_7 204..262 CDD:290234 20/87 (23%)
EFh 204..262 CDD:298682 20/87 (23%)
P4Hc 285..471 CDD:214780 33/184 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92048203
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.