DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and P4htm

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_083220.3 Gene:P4htm MGIID:1921693 Length:503 Species:Mus musculus

Alignment Length:358 Identity:71/359 (20%)
Similarity:123/359 (34%) Gaps:124/359 (35%)


  Fly   209 SGRVHILEATLNIEYRAGELSRALATAE-ELLLLLPMNQGIQKAKRKIEKAMAKKELPKGRGQKS 272
            :||.|.:. ||:::....|:...|:..| .|::.|...:|:|::          :.||....:::
Mouse   130 AGRDHFIR-TLSLKPLLFEIPGFLSDEECRLIIHLAQMKGLQRS----------QILPTEEYEEA 183

  Fly   273 KAKKQISKSTEQLLIEEICRGAKQ--QVTTGSRFNHCQLDGSSPWLLLQPSRLE----PVSSDP- 330
            .:..|:|:.....|:::...|..|  :|...:|.      |:..|  :.|..::    .:.:|| 
Mouse   184 MSAMQVSQLDLFQLLDQNHDGRLQLREVLAQTRL------GNGRW--MTPENIQEMYSAIKADPD 240

  Fly   331 --------------------YIVLHHDVLTPKESNELLQ-----LIDEEEDTKGVSYQSLKLSKL 370
                                |:..|     ..|||||::     .:.:.|....|      :..:
Mouse   241 GDGVLSLQEFSNMDLRDFHKYMRSH-----KAESNELVRNSHHTWLHQGEGAHHV------MRAI 294

  Fly   371 AQKKLGRISRLLGLEILEL-DPWTGRRHG-----HEHI-------------TKL--------EHS 408
            .|:.| |::| |..||:|. :|....|:|     |.|:             |||        |.|
Mouse   295 RQRVL-RLTR-LSPEIVEFSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETS 357

  Fly   409 SELKHVARLMLNLQAPGMGGAVVFPQLE---------------------------LAVNVPRGSL 446
            .....|...:.|:..   ||..|||..:                           |.|...:|:.
Mouse   358 CRYMTVLFYLNNVTG---GGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTA 419

  Fly   447 LHWRTRFAGGSS--SEWDYRSGQAICPVLLGVQ 477
            :.|......|..  .|.|..|....|.|..|.:
Mouse   420 VFWYNYLPDGQGWVGEVDDYSLHGGCLVTRGTK 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
P4htmNP_083220.3 EF-hand_7 193..253 CDD:290234 10/68 (15%)
EFh 195..253 CDD:298682 10/66 (15%)
P4Hc 247..459 CDD:214780 45/223 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92084753
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.