DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and P4ha1

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_742059.2 Gene:P4ha1 RGDID:621000 Length:534 Species:Rattus norvegicus

Alignment Length:527 Identity:127/528 (24%)
Similarity:232/528 (44%) Gaps:77/528 (15%)


  Fly     7 VLW--LLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEE 69
            ::|  |:...||.:..|...|.....|:..|:..|..|:..|:|||:..|.:||:|::....::.
  Rat     1 MIWGVLMMGILLPQCSAHPGFFTSIGQMTDLIHNEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDR 65

  Fly    70 IHS-QVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEES 133
            :.| .....|.::|:|:|.|.::||..:.|..||......:...|...|:.::...|::||...:
  Rat    66 LTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLILKDMSDGFISNLTIQRQYFPNDEDQVGA 130

  Fly   134 LNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALEKLP 194
            ...|..||..|.||:|::|.|.:.|.|..|.::..||.|:.:    ::|:.....|:|.||.:|.
  Rat   131 AKALFRLQDTYNLDTNTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADYYHTELWMEQALMQLE 195

  Fly   195 SASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKAM 259
            ....::.:        :|.:|:......|:.|:|.:||...::||.|.|.:|.........|..|
  Rat   196 EGEMSTVD--------KVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLVYFEYIM 252

  Fly   260 AK-KELPKGRG-----QKSKAKKQ---ISKSTEQLLIEEICRG------AKQQVTTGSRFNHCQL 309
            :| |:..|...     ||:..||:   :....|:...|.:|||      .::|.....|::    
  Rat   253 SKEKDANKSASGDQSDQKTTPKKKGIAVDYLPERQKYEMLCRGEGIKMTPRRQKRLFCRYH---- 313

  Fly   310 DGS-SPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDE------------EEDTKGVS 361
            ||: :|..:|.|::.|.....|.|:..||:::..|    ::::.:            :.:|..::
  Rat   314 DGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAE----IEIVKDLAKPRLSRATVHDPETGKLT 374

  Fly   362 YQSLKLSKLA----------QKKLGRISRLLGLEILELDPWTGRRHG-------HEHITKLEHSS 409
            ....::||.|          .:...||..|.||::...:......:|       |....:.:...
  Rat   375 TAQYRVSKSAWLSGYEDPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPD 439

  Fly   410 ELK------HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQA 468
            ..:      .:|..:..:.....|||.|||::..:|...:|:.:.|...||.|   |.||.:..|
  Rat   440 AFRELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASG---EGDYSTRHA 501

  Fly   469 ICPVLLG 475
            .||||:|
  Rat   502 ACPVLVG 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 37/127 (29%)
P4ha1NP_742059.2 P4Ha_N 24..153 CDD:285528 37/129 (29%)
TPR 205..238 11/33 (33%)
P4Hc 345..518 CDD:214780 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.