DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG34345

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001097101.1 Gene:CG34345 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster

Alignment Length:552 Identity:122/553 (22%)
Similarity:219/553 (40%) Gaps:145/553 (26%)


  Fly     9 WLLQLFL------------LVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIR 61
            |:| |||            :|:.|..:|..|.   |..|.:.|...::.|.:|:..|:::::.:|
  Fly    13 WIL-LFLFTVCKAKKAENDVVQEVIYSNSIRA---LSELREIENSYMEHLNNYVSFLQQKIKTLR 73

  Fly    62 RETSAI--EEIHSQVDSVEEYMGNPLNVFGILKRFESVWPG----LEQKANATLEMVFGERLSDR 120
            ...:::  ..:..:||.. :|:.||||.||:|:|....||.    |:.:.|..:::....:|.:|
  Fly    74 IFINSLTPNYLDHKVDRY-KYVSNPLNSFGLLRRAHQDWPKLIAYLKDQGNIKVDIEEMNKLINR 137

  Fly   121 QLTLPSEEDYEESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVA----RKSDFPV 181
               .|...|.||:|..:..::..|:|.|:.::.|:|.|.:|.|.||..|||.:|    ::|:|..
  Fly   138 ---TPHANDMEEALMGMDRIEHFYDLKSSDMAQGLVAGQQLSSRMSASDCLALADYMYKRSEFRR 199

  Fly   182 ARFWLESALEKLPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQ 246
            |..|...||........|                   :..::.|.:                   
  Fly   200 AAEWYRIALSVFTKPKNN-------------------IAFKFYAPK------------------- 226

  Fly   247 GIQKAKRKIEKAMAKKELPKGRGQK-SKAKKQISKSTEQLL-----------IEEICRG----AK 295
                 ::::||......|.:|..:. :...|::|:.....|           ||:.|:|    ..
  Fly   227 -----RKELEKMFVISRLQEGSVENLTDCLKELSQDPNNSLVHLRPRKSPTMIEQGCQGKFPPGP 286

  Fly   296 QQVTTGSRFNHCQLDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEE------ 354
            |.|   .|:|    ..::|::.:.|.:.|.:|.||.|.|:|||:...|..:|..:..||      
  Fly   287 QLV---CRYN----STTTPFMRIAPLKEEEISRDPLIWLYHDVIYDSEIAQLTNVTREEMILGTT 344

  Fly   355 ------------------EDTKGVSYQSLKLSKLAQKKLGRISRLLGLEILELDPWTGRRHG--- 398
                              :|..|         ||.:..:.|::.:.||::..........:|   
  Fly   345 TNYTTPDRVNRLFHIKVTDDDGG---------KLDKTLVNRMADISGLDVGNTTTLARINYGLGG 400

  Fly   399 ----HEHITKLEHSSELKHVA-RLMLNL----QAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFA 454
                |.....::...||.... |||..|    ..| :||..:||..:||:...:||.|.|.....
  Fly   401 YFQEHSDYMDIKLYPELTEEGDRLMTFLFYMTDVP-VGGTTIFPGAQLAIQPKKGSALFWYNLHN 464

  Fly   455 GGSSSEWDYRSGQAICPVLLGVQLSVIACQSN 486
            .|..   :..:..|:||.::|.:..::....|
  Fly   465 NGDP---NLLTRHAVCPTIVGSRWVLVKSMLN 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 33/132 (25%)
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528 34/137 (25%)
P4Hc 324..489 CDD:214780 35/178 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146328414
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.