DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and p4ha3

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_021322008.1 Gene:p4ha3 ZFINID:ZDB-GENE-041010-4 Length:616 Species:Danio rerio

Alignment Length:545 Identity:140/546 (26%)
Similarity:226/546 (41%) Gaps:112/546 (21%)


  Fly     4 VFSVLWLL--------QLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEI 60
            :|.||:||        ::|..:.||..|            :..|.:|||.|..|||...::||:|
Zfish     7 LFIVLYLLNMPDESFGEMFTSMLSVNQA------------VSAERKLIDHLIIYIEHEAQRLEDI 59

  Fly    61 RRETSAIEEIHSQV-DSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEM-VFGERLSDRQLT 123
            :|..|.:..:|..: :...:.:.||:..|.::||.:|.|..:.....|...: |..|.....:.:
Zfish    60 KRFFSRVTSLHDGIYNEPSDPIANPIAAFKLVKRLKSEWLNVVHSTEAEENIKVLREDYRRMESS 124

  Fly   124 LPSEEDYEESLNHLLHLQSVYELDSNSLSLG-------VVNGFKLGSS--MSWGDCLEVARKS-- 177
            ||..||...:.:.|:.||.||.|...||..|       .|:.:||..|  :|..||..|.:.:  
Zfish   125 LPKLEDLRGAAHGLMRLQDVYNLHVESLVRGHFQQISDPVDFYKLSVSDMLSGDDCFLVGKVAYD 189

  Fly   178 --DFPVARFWLESALEKLPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLL 240
              |:..:..|.|.|: :|...:|.|.|::...|....|:..:    .::.|.:|.||:.:.||||
Zfish   190 LEDYYHSVLWFEEAV-RLFRGTEWSPENEGTLEDALDHLAFS----HFKTGNISHALSLSRELLL 249

  Fly   241 LLPMNQGIQKAKRKIEKAMAKKELPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSRFN 305
            ..|||:.:.....|.||.:.:.......|...|....|...|.. ..|::|:      |.||:..
Zfish   250 HDPMNRRVHFNVEKYEKLLNENLPATSSGLTLKRPDGIYLRTRN-AYEQLCQ------TKGSQPK 307

  Fly   306 HCQ--------LDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQ---------LIDE 353
            |.:        ....||.|.|||.|.|.:|..||:||.|..:|..|:..:.:         ::..
Zfish   308 HFENPSLFCDYFTNGSPALFLQPIRREIISLQPYVVLFHGFVTQAEAKNIRKYAMPGLRRSVVAS 372

  Fly   354 EEDTKGVSYQSLK---LSKLAQKKLG----RISRLLGLEILELDPWT-----------GRRHGH- 399
            ..:.....|:..|   |.:.|.:.:|    ||:.:.||.:  ..|:.           |....| 
Zfish   373 GMNQATAEYRISKSAWLKESAHEVVGKLDQRITLVTGLNV--QPPYAEYLQVVNYGIGGHYEPHF 435

  Fly   400 EHITKLEHSSEL------KHVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSS 458
            :|.|  ..||.|      ..||.:|:.|.....||:..|.....:|.|.:.:.|.|         
Zfish   436 DHAT--SDSSPLYRLKTGNRVATIMIYLSPVQAGGSTAFIYANFSVPVVQNAALFW--------- 489

  Fly   459 SEWD-YRSGQ-------AICPVLLG 475
              |: :::||       |.|||::|
Zfish   490 --WNLHKNGQGNVDTLHAGCPVIVG 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 37/135 (27%)
p4ha3XP_021322008.1 P4Ha_N 27..157 CDD:311993 40/142 (28%)
P4Hc 350..519 CDD:214780 38/179 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92138154
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.