DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and zgc:152670

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001070123.2 Gene:zgc:152670 ZFINID:ZDB-GENE-060929-954 Length:490 Species:Danio rerio

Alignment Length:500 Identity:119/500 (24%)
Similarity:214/500 (43%) Gaps:76/500 (15%)


  Fly    11 LQLFLLVE---SVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIE-EIH 71
            |.||::..   |:....|....:|:..|.:.|..|:|....||:..|..|::::.....:: ...
Zfish     6 LTLFVVCSWFVSITEQEFFSSVDQVSQLFNEEENLLDTFSLYIDAEEENLKKMKSLLLLLQLGSF 70

  Fly    72 SQVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEESLNH 136
            |...|.||.|.:|:..|.:|||....|..:.:....:|...| :.|.|..| :|..||...:...
Zfish    71 SNPQSPEETMRDPVAAFKLLKRLRHEWVNIAKFTQQSLYQEF-QTLLDYSL-IPELEDINSAALG 133

  Fly   137 LLHLQSVYELDSNSLS----LGVVNGFKLGSSMSWGDCLEVARKSD-FPVARFWLESALEKLPSA 196
            |:.||.:|:|..::::    |.....:.:|.         ||.:.| |..|..|...:|.:|...
Zfish   134 LIGLQEIYKLYPHNITKETPLSADEAYYIGL---------VAYEEDKFQHAFLWFLHSLNRLTDF 189

  Fly   197 SENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKAMAK 261
            |..:...          :|....:..|:.|.|..|:...::||.|.|.|:.|     |::..:.:
Zfish   190 SSTTKND----------LLRFLSSSAYQFGSLPVAIYFGQKLLNLDPSNEEI-----KVQLGLYR 239

  Fly   262 KELPKGRGQKSKAKKQISKSTE-QLLIEEICRG------AKQQVTTGSRFNHCQLDGSSPWLLLQ 319
            ..    |.|::......:.:|: ....|.:|||      :|:|.....|::   ..|.:|.|:..
Zfish   240 LI----RLQRTSNPDIFTLNTQSNNSYEALCRGEVDERTSKRQRALSCRYS---TGGGNPRLMYA 297

  Fly   320 PSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTK-----GV-----SYQSLKL------S 368
            |.:.|.:..:|.|:.:|||::..|. |.|:.|...|.|:     ||     :.||:.|      :
Zfish   298 PVKEEELWDEPKIIRYHDVISDTEI-ETLKDIARPELTRSQTGWGVISDIRTSQSVFLEEVGTVA 361

  Fly   369 KLAQKKLGRISRLLGLEILELDPWTGRRH--GHEHITKLEHSSEL-KHVARLMLNLQAPGMGGAV 430
            :::|    ||:.:.||.:...:....:.:  |..:....:...|: :..|..::.:....:|||.
Zfish   362 RISQ----RIADITGLSVESAEKLHVQNYGIGGRYTPHFDTGDEVNERTATFLIYMSDVEVGGAT 422

  Fly   431 VFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLG 475
            ||..:.:||...:||.:.|......|   |.|.::..|.||||:|
Zfish   423 VFTNVGVAVKPEKGSAVFWYNLHKNG---ELDLKTKHAGCPVLVG 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 34/131 (26%)
zgc:152670NP_001070123.2 P4Ha_N 26..150 CDD:285528 33/126 (26%)
P4Hc 318..474 CDD:214780 38/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.