DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and P4HTM

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM HGNCID:28858 Length:563 Species:Homo sapiens

Alignment Length:288 Identity:57/289 (20%)
Similarity:101/289 (35%) Gaps:93/289 (32%)


  Fly   180 PVARFWLESALEKLPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPM 244
            |:.|      ||.:....|...:...:|:    |.:. ||:::....|:...| |.||..|::.:
Human   110 PLTR------LEGIKVGHERKVQLVTDRD----HFIR-TLSLKPLLFEIPGFL-TDEECRLIIHL 162

  Fly   245 NQ--GIQKAKRKIEKAMAKKELPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSRFNHC 307
            .|  |:|::          :.||....:::.:..|:|:.....|:::            :|..|.
Human   163 AQMKGLQRS----------QILPTEEYEEAMSTMQVSQLDLFRLLDQ------------NRDGHL 205

  Fly   308 QLD--------GSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGV-SYQ 363
            ||.        |:..|                       :||:...|:...|..:.|..|| |.|
Human   206 QLREVLAQTRLGNGWW-----------------------MTPESIQEMYAAIKADPDGDGVLSLQ 247

  Fly   364 SLKLSKLAQKKLGRISRLLGLEILEL-----DPWTGRRHGHEHITKLEHSSELKHVARL---MLN 420
              :.|.:..:...:..|....|..||     ..|..:..|..||.:......|: :.||   ::.
Human   248 --EFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLR-LTRLSPEIVE 309

  Fly   421 LQAP------GMGG--------AVVFPQ 434
            |..|      |.||        ..|:|:
Human   310 LSEPLQVVRYGEGGHYHAHVDSGPVYPE 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528
P4HTMNP_808807.2 EF-hand_7 192..252 CDD:290234 17/97 (18%)
EFh 194..252 CDD:238008 17/95 (18%)
P4Hc 246..519 CDD:214780 20/96 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92089498
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.