DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and P4HA1

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_000908.2 Gene:P4HA1 HGNCID:8546 Length:534 Species:Homo sapiens

Alignment Length:527 Identity:130/528 (25%)
Similarity:238/528 (45%) Gaps:77/528 (15%)


  Fly     7 VLWLLQL--FLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEE 69
            ::|.:.:  .||.:|:|...|.....|:..|:.||..|:..|:|||:..|.:||:|::....::.
Human     1 MIWYILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDR 65

  Fly    70 IHS-QVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEES 133
            :.| .....|.::|:|:|.|.::||..:.|..||......:...|...|:.::...|::||...:
Human    66 LTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGA 130

  Fly   134 LNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR----KSDFPVARFWLESALEKLP 194
            ...||.||..|.||::::|.|.:.|.|..|.::..||.|:.:    ::|:.....|:|.||.:|.
Human   131 AKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADYYHTELWMEQALRQLD 195

  Fly   195 SASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKAM 259
            ....::.:        :|.:|:......|:.|:|.:||...::||.|.|.:|......:..|..|
Human   196 EGEISTID--------KVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIM 252

  Fly   260 AK-KELPKGRG-----QKSKAKKQ---ISKSTEQLLIEEICRG------AKQQVTTGSRFNHCQL 309
            || |::.|...     ||:..||:   :....|:...|.:|||      .::|.....|::    
Human   253 AKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKMTPRRQKKLFCRYH---- 313

  Fly   310 DGS-SPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDE------------EEDTKGVS 361
            ||: :|..:|.|::.|.....|.|:..||:::..|    ::::.:            :.:|..::
Human   314 DGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAE----IEIVKDLAKPRLSRATVHDPETGKLT 374

  Fly   362 YQSLKLSKLA----------QKKLGRISRLLGLEILELDPWTGRRHG-------HEHITKLEHSS 409
            ....::||.|          .:...||..|.||::...:......:|       |....:.:...
Human   375 TAQYRVSKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPD 439

  Fly   410 ELK------HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQA 468
            ..|      .:|..:..:.....|||.|||::..:|...:|:.:.|...||.|   |.||.:..|
Human   440 AFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASG---EGDYSTRHA 501

  Fly   469 ICPVLLG 475
            .||||:|
Human   502 ACPVLVG 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 38/127 (30%)
P4HA1NP_000908.2 P4Ha_N 24..153 CDD:311993 38/129 (29%)
TPR 205..238 11/33 (33%)
P4Hc 345..518 CDD:214780 35/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10869
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.