DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and PH4alphaPV

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_733395.1 Gene:PH4alphaPV FlyBaseID:FBgn0051015 Length:525 Species:Drosophila melanogaster

Alignment Length:537 Identity:135/538 (25%)
Similarity:221/538 (41%) Gaps:106/538 (20%)


  Fly     1 MPVVFSVLWLLQLFLLVESVAGANFARGEEQ-------LQALLDTETQLIDGLRDYIERLERQLE 58
            :||  .||...|:.||:     ...|:|||.       :..|||.|.||||.|.||...||::|:
  Fly     8 LPV--RVLLTYQVLLLL-----LRQAKGEESHCTSVAGMVKLLDLEAQLIDNLEDYAVELEKKLQ 65

  Fly    59 EIRRETSAIE-EIHSQVDSVEEYMGNPLNVFGILKRFESVW----------PGLEQKANATLEMV 112
            .:||..:::. |......|.|||:.||||.|.:::|....|          .|:.|.        
  Fly    66 TVRRSITSLRLENDKARSSTEEYLSNPLNSFSLIRRMNRDWIIWQLYMDDPVGISQV-------- 122

  Fly   113 FGERLSDRQLTLPSEEDYEESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR-- 175
              ||:.:.:..:|:..|.||::..|..:||.|.|....:|.|.:||.:...|::..|...:.:  
  Fly   123 --ERIQELREHMPTHTDVEEAVTALDRIQSTYGLKVPEISHGFLNGKQYNVSLTVLDTYAMGQIL 185

  Fly   176 --KSDFPVARFWLESALEKLPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEEL 238
              :.::..|..|:..:: .|..|...:...:..:...|:...|..|.:...|..|.         
  Fly   186 FDQKNYLAAASWIYQSV-VLMEAFSMAAPLEISKNEVRMVYAETLLKLNQHADALK--------- 240

  Fly   239 LLLLPMNQGIQKAKRKIEKAMAKKELPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSR 303
            ::.:.:.......|..::|:..:..:..|.......|.|.:.......|.  |||  |...:...
  Fly   241 VVNIALTDNPHDIKLLLKKSEIETMIRTGTNNAPPVKVQATGVPTAYQIG--CRG--QFPPSADS 301

  Fly   304 FNHCQLD-GSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKL 367
            ..:|..: .:||:|:|.|.::|.|..|||:||:||||:|||..||          :|::...||.
  Fly   302 KLYCLYNRTTSPFLILAPLKMELVGLDPYMVLYHDVLSPKEIKEL----------QGMATPGLKR 356

  Fly   368 SKLAQKKLG----------------------------RIS-----RLLGLEILELDPWTGRRHGH 399
            :.:.|...|                            |||     .|.|.|:|:|..:....|..
  Fly   357 ATVYQASSGRNEVVKTRTSKVAWFPDGYNPLTVRLNARISDMTGFNLYGSEMLQLMNYGLGGHYD 421

  Fly   400 EHITKLEHSSEL------KHVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSS 458
            :|......::..      ..:|.::..|.....|||.|||.:..||...|||::.|......|  
  Fly   422 QHYDFFNKTNSNMTAMSGDRIATVLFYLTDVEQGGATVFPNIRKAVFPQRGSVVMWYNLKDNG-- 484

  Fly   459 SEWDYRSGQAICPVLLG 475
             :.|.::..|.|||::|
  Fly   485 -QIDTQTLHAACPVIVG 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 44/144 (31%)
PH4alphaPVNP_733395.1 P4Ha_N 35..164 CDD:285528 43/139 (31%)
TPR_11 179..250 CDD:290150 9/81 (11%)
TPR repeat 179..213 CDD:276809 4/35 (11%)
TPR repeat 218..248 CDD:276809 5/39 (13%)
P4Hc 339..510 CDD:214780 41/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146323620
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.