DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG31021

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_733392.2 Gene:CG31021 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster

Alignment Length:515 Identity:106/516 (21%)
Similarity:195/516 (38%) Gaps:138/516 (27%)


  Fly    35 LLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIHSQVDSV----EEYMGNPLNVFGILKRFE 95
            :|:.|..|:..:|||.|:||.:::.|   .:.:|:.:..::..    |:|:.||||.|.:::...
  Fly     1 MLNLERNLLQNMRDYAEKLEEKIDLI---NNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRHMH 62

  Fly    96 SVWPGLE------------QKANATLEMVFGERLSDRQLTLPSEEDYEESLNHLLHLQSVYELD- 147
            ..|.|.:            ||..:.|..            ||.:|.:.::...:..|...|..: 
  Fly    63 QDWVGWQVYMEDLVAPEAVQKVESLLPQ------------LPQKEAFRKAARSVHSLTQFYGYEP 115

  Fly   148 ---------SNSLSLGVVNGFKLGSSMSWGDCLEVARKSDFPVARFWLESALEKLPSASENSTES 203
                     |:||.|..::.:.||        ||:..:.|:..|..||:       .|:.|.|.|
  Fly   116 ADLVAKDERSSSLHLSPLDCYHLG--------LELYEEQDYLGAAKWLQ-------VAAHNYTLS 165

  Fly   204 QRE--------------RESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRK 254
            :..              |:.||. :|:......|.|         .|..|.|...|..:.|...:
  Fly   166 RHRDLFNPLGAPRWQVYRDLGRT-LLKLNRQCAYDA---------YESALRLNSQNVHLMKEAGQ 220

  Fly   255 IEKAMAKKELPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSRFNHCQL-DGSSPWLLL 318
            :|....:..:          :..:....:..::|:.|||   :|........|:| |....:|..
  Fly   221 MELFSLRDPM----------EPILDLQPKPTVLEKYCRG---EVPRHQGRLTCELNDWVHSFLAY 272

  Fly   319 QPSRLEPVSSDPYIVLH------HDVLTPKESNELLQLIDEEEDTKGVSYQSLK--LSKLAQKKL 375
            .|.:.|.:..||:|:|:      .::...:.:.|.....|..|...|:|..|:.  .|.:.::..
  Fly   273 APIKFEDLQQDPFIILYPGSIYEQEIRHVENAYERCPPNDRFELKLGISGCSISDGYSPVLKRIN 337

  Fly   376 GRISRLLGLE-------ILE---LDPWTGRRHGHEHITKLEHSSELKHV---------ARLMLNL 421
            .||..:.|:|       |:|   |.|:       |......:|::...:         |::::.|
  Fly   338 ERILDMAGVEKTWDTFYIVEYAQLAPF-------EPFKLFRNSTKFPKLNLMNFEDVEAKVIIFL 395

  Fly   422 QAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLGVQLSVI 481
            :...:|||...|..::.|...||::|   ..|.....|       ..|||::.|..|.:|
  Fly   396 KDVTLGGAFTMPNGDILVQPKRGNVL---ITFENEEHS-------TTICPIIEGTGLVMI 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 32/147 (22%)
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 28/133 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92001526
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.