DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG9698

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_651806.2 Gene:CG9698 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster

Alignment Length:547 Identity:118/548 (22%)
Similarity:217/548 (40%) Gaps:120/548 (22%)


  Fly     4 VFSVLWLLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIE 68
            |||||:|| ....:.||:|..|.....::..:...|.:::..::.::...:.:|:.::   :.:.
  Fly     5 VFSVLFLL-FHQAIPSVSGVEFFSSIHEMTKVFGYEQKMVLHMQKFLSDNQDKLDFLK---ARLR 65

  Fly    69 EIHSQVDSVEE----YMGNPLNVFGILKRFESVWPGLEQ-KANATLEMVFGERLSDR------QL 122
            |..::.:...|    |..:|:|.:.:.||....|..:|. .|.:|     ||:...|      :.
  Fly    66 EFENERNEAREWGPSYFESPINKYLLNKRLTVDWQRVENLMATST-----GEKPLTRLRKFRNRE 125

  Fly   123 TLPSEEDYEESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVAR---KSDFP-VAR 183
            |:|.:::.|.:::.||.||.||.|.:..|:.|:::|...|:.::...|:::||   :...| :|.
  Fly   126 TMPDKKELEGAIDGLLRLQYVYRLKAKDLARGILDGVDYGTQLNSEHCVDIARLALRDQHPRLAH 190

  Fly   184 FWLESALEKLPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGI 248
            .||..|.::|       |..::| |..:..||...:..:....:......|.:||:       ||
  Fly   191 SWLIEANDRL-------TGGEKE-EQLKPQILALLVQAKKELEDFRGLNDTYQELI-------GI 240

  Fly   249 QKAKRKIEK-------AMAKKEL------------------PKGRGQKSKAKKQISKSTEQLLIE 288
            |.|..:..|       |:::|.|                  |.|..|....              
  Fly   241 QSASEEHAKNYETFLNALSEKALLNESKPILEHAPIPEEGEPVGEFQAYSL-------------- 291

  Fly   289 EICRGAKQQVTTGSRFNHC-QLDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKE--------S 344
             .|.|..:......|...| .:..:.|:|.:.|.:.|.:..||.:||:|||:...|        .
  Fly   292 -TCSGHWRLTPKEQRHLRCGYVTETHPFLWIAPLKAEELFQDPLLVLYHDVIYQSEIDVIRKLTE 355

  Fly   345 NELLQLIDEEEDTKGVSYQSLKLSKL------AQKKLGRISRLLGLEILELDPWTGRRH------ 397
            |.|::......:...||  :::.|:.      |.|.|..|.:.:. ::..|:......|      
  Fly   356 NRLMRATITSHNESVVS--NVRTSQFTFIPVTAHKVLSTIDQRVA-DMTNLNMKYAEDHQFANYG 417

  Fly   398 --GH--EHI---------TKLEHSSEL-KHVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLH 448
              ||  :|:         ..|..|.|: ..:|.::..|.....||...||||...:...:.:...
  Fly   418 IGGHYGQHMDWFYQTTFDAGLVSSPEMGNRIATVLFYLSDVAQGGGTAFPQLRTLLKPKKYAAAF 482

  Fly   449 WRTRFAGGSSSEWDYRSGQAICPVLLG 475
            |....|.|..   |.|:....||::.|
  Fly   483 WHNLHASGVG---DVRTQHGACPIIAG 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 28/137 (20%)
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528 28/139 (20%)
P4Hc 345..516 CDD:214780 34/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146323912
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.