DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and PH4alphaNE2

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_733378.1 Gene:PH4alphaNE2 FlyBaseID:FBgn0039783 Length:542 Species:Drosophila melanogaster

Alignment Length:524 Identity:117/525 (22%)
Similarity:211/525 (40%) Gaps:77/525 (15%)


  Fly     3 VVFSVLWL-LQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSA 66
            |:..:|:| |....|.|:.|...|||....:..:|:.|..|:..:....|.|.|:.:.|:.....
  Fly     7 VLLGMLYLSLSFGQLRENNAQQRFARSVVNMDDMLNLEDDLVSNVEKLAEALARKAKTIKWGVFK 71

  Fly    67 IEEIHSQVDSVEEYMGNPLNVFGILKRFESVW----------PGLEQKANATLEMVFGERLSDRQ 121
            :.:...:..|..|...||::.|.:::..:|.|          .|.|       |:.|   :..|.
  Fly    72 MMKRRQEYKSSMEIFANPIDTFSLIRHMQSNWLMWLLYLETPVGQE-------ELFF---VDSRM 126

  Fly   122 LTLPSEEDYEESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVA----RKSDFPVA 182
            ..||...|:.::...:..:|:.|::.|:.::.|:::|.:..||:...|||.:.    ..|.:..|
  Fly   127 PLLPKYFDFIDAAEGIRKMQATYQMFSSDIAKGLLDGVQYNSSLKPIDCLAIGLHLMNNSRWYAA 191

  Fly   183 RFWLESALEKLPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQG 247
            ..|:.:::|.....| :.|:.:..|......:......::.:......||...:..|.|.|.:..
  Fly   192 EQWISASIEAYDQKS-SQTDMELLRGPKLADLCRILGQVQMKQRNHEGALQAYQVALKLSPHDPE 255

  Fly   248 IQKAKRKIEKAMAKKELPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSR----FNHCQ 308
            |.:..|.:|    |::|.....:..:..|  ..|.|:|::...|.|..|.....|.    :||. 
  Fly   256 IYEEYRILE----KRDLTLSDIEPIEQDK--DNSHERLVLPPCCSGRCQVPRNLSNLYCVYNHV- 313

  Fly   309 LDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQL----------------------I 351
               :||:|.|.|.:.|.:|.||::||.||:::.|||. |::.                      :
  Fly   314 ---TSPFLQLAPIKTEILSIDPFVVLLHDMISQKEST-LIRTSSKEHMLPSATTDPDASDDETQV 374

  Fly   352 DEEEDTKGVSYQSLKLSKLAQKKLGRISRLLGLEILELDPWTGRRHG-----HEHITKL-----E 406
            |....:|.|.|.| ..:...:|...|:....||::...:.:....:|     ..|:..|     .
  Fly   375 DTYRTSKSVWYSS-DFNDTTKKITERLGDATGLDMNSTEFYQVINYGLGGFFETHLDMLLSEKNR 438

  Fly   407 HSSELKHVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICP 471
            .:.....:|..:..|.....||...||:|.|.|....||.|.|......|:.......:|   ||
  Fly   439 FNGTSDRIATTLFYLNEVRQGGGTYFPRLNLTVFPQPGSALFWYNLDTKGNDHMGSLHTG---CP 500

  Fly   472 VLLG 475
            |::|
  Fly   501 VIVG 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 26/136 (19%)
PH4alphaNE2NP_733378.1 P4Ha_N 33..161 CDD:285528 26/138 (19%)
TPR repeat 175..200 CDD:276809 5/25 (20%)
TPR_16 176..254 CDD:290168 13/79 (16%)
TPR repeat 219..249 CDD:276809 3/30 (10%)
TPR_2 220..253 CDD:285020 5/33 (15%)
P4Hc 342..513 CDD:214780 35/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146325392
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.