DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and PH4alphaNE1

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_733374.1 Gene:PH4alphaNE1 FlyBaseID:FBgn0039780 Length:537 Species:Drosophila melanogaster

Alignment Length:525 Identity:139/526 (26%)
Similarity:232/526 (44%) Gaps:84/526 (16%)


  Fly     7 VLWLLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIH 71
            ||.:..:|||.:....:::......|:.||.||..|...||..:..::..|:::..|.|:||:.|
  Fly     5 VLLVGLIFLLAQGSLASDYFSSITGLEDLLHTEQYLTRELRSKVNAIQTALQQLESELSSIEKEH 69

  Fly    72 SQVDS-VEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEESLN 135
            :...| .|.|:.||:||:.::||..:.|..:|.:.....|.:......:..|:.||:||.|.:..
  Fly    70 TMAASDTENYLTNPVNVYRLMKRLHTDWSLMEGRVQLMAEEMNFNATREYGLSYPSQEDVEGAAL 134

  Fly   136 HLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVARK----SDFPVARFWLESALEKLPSA 196
            .|:.|||.|:||...::.|::||.|.||.|||.||.|:.::    .|:...:.||..::|:|...
  Fly   135 ALVRLQSTYKLDVAQVAQGILNGVKYGSDMSWQDCFELGQQLFEMEDYNNTKVWLRESMERLRRQ 199

  Fly   197 SENSTESQRERESG----RVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKI-- 255
            :.:: .|.....||    .::.:|||....::.|:...|...::.:|...|         ::|  
  Fly   200 TSHA-PSHLAPTSGPDTVTLNKMEATAKSLFQLGDFDTAFELSQRVLQFDP---------KRIRN 254

  Fly   256 ----EKAMAKKE------LPKGRGQKSKAKKQISKSTEQLLIEEICRG-----AKQQVTTG-SRF 304
                :|..|..|      ||       |.....|.|.|....|::|||     .:|::... ||.
  Fly   255 WHLGDKGTAPPEDIDDVYLP-------KHSDSYSLSQEFAKYEKVCRGEVHPIVRQELRCRYSRG 312

  Fly   305 NHCQLDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVS-------- 361
            ||       |:..|.|.:||..|.|||:...||:|:|.:.::|.::.........|:        
  Fly   313 NH-------PYRFLAPLKLEEHSLDPYVATFHDILSPGKISQLREMAVPRMHRSTVNPLPGGQLK 370

  Fly   362 YQSLKLSKLAQKKLGRISRLLGLEILELDPWTGRR--------------HGH-----EHITKLEH 407
            ..:.::||.|.........::|: :.:|...||..              .||     :......|
  Fly   371 KSAFRVSKNAWLAYESHPTMVGM-LRDLKDATGLDTTFCEQLQVANYGVGGHYEPHWDFFRDPNH 434

  Fly   408 --SSELKHVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAIC 470
              :.|...:|..:..|.....|||..||.|::||....|::|.|   :....|.:.|||:..|.|
  Fly   435 YPAEEGNRIATAIFYLSEVEQGGATAFPFLDIAVKPQLGNVLFW---YNLHRSLDKDYRTKHAGC 496

  Fly   471 PVLLG 475
            |||.|
  Fly   497 PVLKG 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 40/127 (31%)
PH4alphaNE1NP_733374.1 P4Ha_N 26..155 CDD:285528 40/129 (31%)
P4Hc 341..511 CDD:214780 37/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146323448
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.