DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and PH4alphaMP

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_524594.2 Gene:PH4alphaMP FlyBaseID:FBgn0026190 Length:535 Species:Drosophila melanogaster

Alignment Length:557 Identity:133/558 (24%)
Similarity:226/558 (41%) Gaps:116/558 (21%)


  Fly    13 LFLLVESVA-GANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIH-SQVD 75
            |||:::.:: ...|......|..|.:||..|:..|::|:..:.:..|.::.|..||...| :..|
  Fly     8 LFLVLQVLSCHGEFFSSTSGLAKLFETEVVLLAELQNYVNEINQHAEALQSEIDAIRVEHLNAAD 72

  Fly    76 SVEEYMGNPLNVFGILKRFESVWPGLEQKANA---------TLEMVFGERLSDRQLTLPSEEDYE 131
            .:::|:.||:|.|.::||..|.|...|....|         |:..:      ...|:.||::|:.
  Fly    73 GIDDYLNNPVNAFRLIKRLHSDWETFEGSVTADSSRSNYLDTMASL------KENLSFPSQDDFV 131

  Fly   132 ESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVARK----SDFPVARFWLESALEK 192
            .|...|..||..|:||...|:.|::||.|.|::|||.||..:.:.    .|:.....||:.:::.
  Fly   132 GSAIALTRLQQTYQLDVAELASGILNGVKYGTAMSWQDCFVLGQHLYALRDYNHTVPWLQQSMQL 196

  Fly   193 LPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLP-MNQGIQKAKRKIE 256
            |...|..|       ||..:..:||.:......|....||:....:|.:.| ....:.:|::::|
  Fly   197 LGEQSYGS-------ESASLDFMEAVVEYHREMGAHESALSLVNHVLSIEPDQRSHLLEARQQLE 254

  Fly   257 KAMAKKELPKGRGQK-------SKAKKQISKSTEQLLIEEICRGAKQQVTTGSRFNHCQLDGSSP 314
            :.:..       |.|       ::......:|.|..:.|::|||....:.:..|...|:|..|. 
  Fly   255 ELITD-------GDKNGLLHLTARRPGDYHESREFRMYEQVCRGELAPLPSKQRNLRCRLRKSR- 311

  Fly   315 WLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEE--------------------EDTKG 359
             |...|.:||.:..||.:|..|.|:..|:|:.|.:.....                    ..::|
  Fly   312 -LGYAPFKLEELHLDPLVVQLHQVIGSKDSDSLQKTARPRIKRSTVYSLGGNGGSTAAAFRTSQG 375

  Fly   360 VS--YQSLKLSKLAQKKLGRISRLLGLEILE------------LDP-W----------TGRRHGH 399
            .|  |.....:||..:.:|..|. |.::..|            .:| |          .|..||:
  Fly   376 ASFNYSRNAATKLLSRHVGDFSG-LNMDYAEDLQVANYGIGGHYEPHWDSFPENHIYQEGDLHGN 439

  Fly   400 EHITKLEHSSELKHVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYR 464
            ...|.:.:.::::             .||...||.|.|.|...|||||.|......|   :.|:|
  Fly   440 RMATGIYYLADVE-------------AGGGTAFPFLPLLVTPERGSLLFWYNLHPSG---DQDFR 488

  Fly   465 SGQAICPVLLGVQLSVIACQSNVLRDTLYGPRGQDSI 501
            :..|.||||.|         |..:.:.....|.||::
  Fly   489 TKHAACPVLQG---------SKWIANVWIRERNQDNV 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 38/136 (28%)
PH4alphaMPNP_524594.2 P4Ha_N 24..156 CDD:285528 38/138 (28%)
P4Hc 336..509 CDD:214780 41/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146329148
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.