DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and PH4alphaSG2

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_651801.1 Gene:PH4alphaSG2 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster

Alignment Length:505 Identity:123/506 (24%)
Similarity:215/506 (42%) Gaps:61/506 (12%)


  Fly    10 LLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIHSQV 74
            :.||.:.| .||...|....:.:|.|...|.:|::..|.|:|..::||:..||....|:..|...
  Fly    11 IFQLIIWV-GVANGEFYSSVDSMQDLAQVEEELLNATRSYVESQQKQLDFYRRYVEQIKREHEWA 74

  Fly    75 DS---VEEYMGNPLNVFGILKRFESVWPGLEQK---ANATLE--MVFGERLSDRQLTLPSEEDYE 131
            .|   :::|:|:||:.|.::||....|..|..:   ||...|  ..|.|.|| |.|..|.:.:.:
  Fly    75 TSQLKLDDYLGHPLHAFRLIKRLVRDWDSLIFEPILANNAREEFRAFVEVLS-RDLGYPDQSELQ 138

  Fly   132 ESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVARK----SDFPVARFWLESALEK 192
            .::..|..||.||.|.::.|:.|::.|...||.:.|.:|.|:..:    .::..:..||:.|...
  Fly   139 GAIKGLARLQKVYNLATSDLADGIIGGLNYGSDLRWRECYEIGVQLFDLGEYQRSLEWLQVAFIL 203

  Fly   193 LPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEK 257
            |    .||...:::.:.....|.|......:..|...:|.....::|...|.:.. |:.::.:|.
  Fly   204 L----RNSPREEKDADHYLSDIREYASMANFELGNPKKAARLLSQILESQPTHSA-QQTQKYLES 263

  Fly   258 AMAKKELPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSRFNHCQLDGS-SPWLLLQPS 321
            .:..|.:     |::| ....|..|      .:|:|.:...........|.|||. ..:..|.|.
  Fly   264 RVPGKNV-----QETK-PSWFSNYT------RLCQGRRLPEERSGDPLRCYLDGKRHAYFTLAPL 316

  Fly   322 RLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKG---------------VSYQS-LKLSKL 370
            ::|||..||.|.::|.:|:.|:...:.:..|:||..:.               ||.|: |.....
  Fly   317 QVEPVHLDPDINVYHGMLSSKQILSIFEEADKEEMVRSAVAGSGGEGTVRDLRVSQQTWLDYKSP 381

  Fly   371 AQKKLGRISR------LLGLEILELDPW--TGRRHGHEHI--TKLEHSSELKHVARLMLNLQAPG 425
            ....:|||.:      :.|.|.:::..:  .|:...|...  ..|..:.|...::..|..|....
  Fly   382 VMNSVGRIIQFVSGFDMAGAEHMQVANYGVGGQYEPHPDYFEVNLPKNFEGDRISTSMFYLSDVE 446

  Fly   426 MGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLG 475
            .||..||.:|.:.:...:|:|:.|....   .|...|.|:..|.|||::|
  Fly   447 QGGYTVFTKLNVFLPPVKGALVMWHNLH---RSLHVDARTLHAGCPVIVG 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 41/134 (31%)
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528 41/136 (30%)
P4Hc 335..503 CDD:214780 35/163 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146323476
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.