DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and PH4alphaEFB

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_733371.1 Gene:PH4alphaEFB FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster

Alignment Length:529 Identity:134/530 (25%)
Similarity:229/530 (43%) Gaps:60/530 (11%)


  Fly     1 MPVVFSVLWLLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETS 65
            |...:.::.||.:.|||...|.........:::.||:||:.||..|..||...|.:|..::.:..
  Fly     1 MAADWRLMLLLGILLLVGGPANGEVYTALAEMEELLETESVLITNLEGYIRVQEDKLNFLKNKMD 65

  Fly    66 AIEEIHSQVD-SVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQ--LTLPSE 127
            ..:..||... .:..|:.||:|.:.:.||..:.|..:|......:...|.:.::..:  |..||:
  Fly    66 EYQREHSDASHDITAYVSNPINAYLLTKRLTTDWRQVENLMEHDVGTDFLQNITQYRSLLKFPSD 130

  Fly   128 EDYEESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVARKS----DFPVARFWLES 188
            ||...:...||.||..|:||::|::.|.:||.:..:.||..||.|:.|:|    |:.....|:..
  Fly   131 EDLNGAAVALLRLQDTYQLDTSSVARGKLNGIQYSTEMSSDDCFELGRQSYVNHDYYHTVLWMNE 195

  Fly   189 ALEKLPSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKR 253
            |:.::.....|.|:|..:.:     |||......|:.|.:..||....|||.|||.::.....||
  Fly   196 AMARMLEEPTNHTQSFTKAD-----ILEYLAFSTYKEGNIESALTMTNELLQLLPHHERANGNKR 255

  Fly   254 KIEKAMAKK-------------ELPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSRFN 305
            ..||.:|::             |:||.....:|:...|...||:...|.:|||..:...:..|..
  Fly   256 FYEKEIAQQLQLRKMKGDDGTDEMPKSDLPVAKSDPAIFDMTERRAYEMLCRGELKPSPSDLRSL 320

  Fly   306 HCQ-LDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLID--------EEEDTKGVS 361
            .|: :....|:|.|.|.:||.|.:|||||::||.:...|.:.:.::..        :...|..:.
  Fly   321 RCRYVTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDSEIDLIKRMARPRFRRATVQNSVTGALE 385

  Fly   362 YQSLKLSKLAQKK----------LGRISRLLGLEILELDPWT-------GRRHGHEHITKLEHSS 409
            ..:.::||.|..|          :.|.:.:.||::...:...       |....|....:.|...
  Fly   386 TANYRISKSAWLKTQEDRVIETVVQRTADMTGLDMDSAEELQVVNYGIGGHYEPHFDFARKEEQR 450

  Fly   410 ELK------HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQA 468
            ..:      .:|.::..:.....|||.||..|..|:...:|:...|......|   :.|.|:..|
  Fly   451 AFEGLNLGNRIATVLFYMSDVEQGGATVFTSLHTALFPKKGTAAFWMNLHRDG---QGDVRTRHA 512

  Fly   469 ICPVLLGVQ 477
            .||||.|.:
  Fly   513 ACPVLTGTK 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 36/129 (28%)
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528 36/131 (27%)
P4Hc 356..529 CDD:214780 31/170 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146323417
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.