DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG32199

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_730347.1 Gene:CG32199 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster

Alignment Length:530 Identity:114/531 (21%)
Similarity:218/531 (41%) Gaps:138/531 (26%)


  Fly    32 LQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIH-SQVDSVEEYMGNPLNVFGILKRFE 95
            :..||:.|..|...|..|::.::.:|:.|:....:::.:. :.::..|||:.||||.|.:|:|..
  Fly    10 MMKLLEMEESLKTNLDIYVQEMQSKLDLIKLYQDSLKRVTLTTLEEKEEYVSNPLNAFPMLRRLN 74

  Fly    96 SVWPGLEQKANATLEM-VFGERLSDRQLTL---PSEEDYEESLNHLLHLQSVYELDSNSLSLGVV 156
            ..||    |....::: :..:::.:.::.|   |.::|.:.:|..:..::..:.|.:..|:.||:
  Fly    75 QDWP----KWLRYIKLAIASKKIKEMEVQLKSAPIDDDLKVALKGMTRIEKFHNLHAEDLTKGVL 135

  Fly   157 NGFKLGSSMSWGDCLEVA----RKSDFPVARFWLESALEKLPSASENSTESQRERESGRVHILEA 217
            .|.||.|.::..||:.:.    .::.|..:..|...||                    |||    
  Fly   136 MGKKLNSHLTAPDCVALGDYYYNQTQFSGSTHWYRMAL--------------------RVH---- 176

  Fly   218 TLNIEYRAGELSRALATAEELLLLLPMNQGIQKAK--RKIEKAMAKKEL--------PKGRGQKS 272
                     ...|.:..|:.|        |:::.:  :|..||:.|:.|        |..:.:.:
  Fly   177 ---------THPRGMIYAKVL--------GLKRKRIYKKYAKALLKESLNSDKSKPTPTEKSEWN 224

  Fly   273 KAKKQISK---------------STEQLLIEEI--------------CRG---AKQQVTTGSRFN 305
            :..|::::               |.::.:.:|:              |||   .|.......|:|
  Fly   225 RLAKEVTREDNYDNVKKLIDEYLSGDEKIFQEVAARLKRKPTKLERGCRGEWPKKSSPELICRYN 289

  Fly   306 HCQLDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELL-------QLID----EEEDTKG 359
            .    .:|.:|.|.|.:||.:|..|.|:|:||||...|...:.       .:||    .:.|.||
  Fly   290 R----DTSAFLKLAPLKLEFLSVQPMILLYHDVLYENEFKSMRDIAMYNGSMIDGWTYVDFDKKG 350

  Fly   360 VSYQSLKLSKL-------AQKKLG---RISRLLGLE-----ILELDPWTGRRHGHEHITKLEHSS 409
            ...|..::.|:       |...|.   |::.:.|||     :|.|..:....|..:|:..:|.:.
  Fly   351 NPKQQDRVVKMIAFQGTTAPFTLSINRRMADMSGLEMRDNMVLYLTNYGLGGHFGKHVDYVELAK 415

  Fly   410 EL---------KHVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRS 465
            ..         ..:|..::......:||..||.:|::||...:||.|.|   |....:.|.|..:
  Fly   416 RPPDFFADFGGDRIATALIYASDIPLGGTTVFTKLKIAVQPKKGSALIW---FNLNHAGEPDPLT 477

  Fly   466 GQAICPVLLG 475
            ..::|||:||
  Fly   478 EHSVCPVVLG 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 29/129 (22%)
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528 29/129 (22%)
P4Hc <369..497 CDD:214780 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146324329
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.