DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG18231

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_649045.2 Gene:CG18231 FlyBaseID:FBgn0036796 Length:470 Species:Drosophila melanogaster

Alignment Length:476 Identity:115/477 (24%)
Similarity:216/477 (45%) Gaps:85/477 (18%)


  Fly    31 QLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIE-EIHSQVDSVEEYMGNPLNVFGILKRF 94
            :|..||:.|...|..::.|..:|..:::.::....::: |.....:..|:|:|||:|.|.:::|.
  Fly    22 RLLKLLEMEEIFITNIKAYTNKLAEKVKNLQAYIDSVDYEFQQSFEDREKYVGNPINAFSLVRRT 86

  Fly    95 ES---VWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEESLNHLLHLQSVYELDSNSLSLGVV 156
            ..   .|....|:. ..:|.:|.  |.:....:|.::|...||..:..::.:|:|::..|:.|.:
  Fly    87 HQDLPKWHNYSQQI-VGMEELFA--LEEIIAKVPDKKDMAYSLGEMHRIEQIYDLEAIELARGRI 148

  Fly   157 NGFKLGSSMSWGDCLEVA----RKSDFPVARFWLESALEKLPSASENSTESQRERESGRVHILEA 217
            .|.:.....|..||:.:.    ::.|:..|..|...|::..|              .|...|:.:
  Fly   149 QGKQYDFRPSIRDCVALGEHKFKREDYQRASMWFRVAIKHEP--------------EGNAEIINS 199

  Fly   218 TLNIEYRAGELSRALAT--AEELLL--LLPMNQG--IQKAKRKIEKAMAKKELPKGRGQKSKAKK 276
            .|      |:....|.|  |:.:|:  ::..|..  |.:||:...:|:.|..|   ...||...:
  Fly   200 IL------GDPKVNLYTLYAKSMLIFGMIKSNPSMTIAEAKKISYEALNKASL---ADIKSLLNE 255

  Fly   277 QISKSTEQLLIE-----------EI-CRGAKQQVTTGSRFNH-CQLDGS-SPWLLLQPSRLEPVS 327
            .:|::.::::.|           || |||...:     |.|| |..:.: :.:|.|.|.:.|.::
  Fly   256 LLSQTDDEIVYEMNVNKTKPSDYEIGCRGQFLR-----RRNHVCTYNFTITEFLKLAPLKQEVLN 315

  Fly   328 SDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLKLSKLAQKKLGRISRLLGLEILELDPW 392
            .|||||::||||...|.::|...:::.:        :::::.:.::...||:.|..|.....|..
  Fly   316 WDPYIVIYHDVLNDDEIDKLKNHLNDTD--------AVEVNPIEKRIFQRINELTRLSFEHSDQQ 372

  Fly   393 TGRRHG---HEHITKLEHSSELKHVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFA 454
            ...::|   |:|  |.|:   ||  ..|:..|....:|||:|||:|:::|...:||.|.|.... 
  Fly   373 IVSKNGPRTHKH--KKEY---LK--GTLLFFLNNVELGGAMVFPKLKISVFPQKGSCLFWHNTL- 429

  Fly   455 GGSSSEWDYRSGQAICPVLLG 475
                   |.||....||||.|
  Fly   430 -------DPRSEPLECPVLQG 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 29/129 (22%)
CG18231NP_649045.2 P4Ha_N 19..148 CDD:285528 29/129 (22%)
2OG-FeII_Oxy 322..449 CDD:304390 40/146 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146330914
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.