DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG18233

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_649044.3 Gene:CG18233 FlyBaseID:FBgn0036795 Length:515 Species:Drosophila melanogaster

Alignment Length:547 Identity:132/548 (24%)
Similarity:218/548 (40%) Gaps:133/548 (24%)


  Fly     6 SVLWLLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEI 70
            |||.|::| |.:|.....||:.....||       :.:|.|..:::.|:|...:...|.      
  Fly    34 SVLGLVKL-LKMEQEFMVNFSIYANILQ-------EKVDNLNIFLDALKRPNHKTHNER------ 84

  Fly    71 HSQVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTLPSEEDYEESLN 135
                   |:::.||||.||:::|....||.|:......|.:.....:.|.....|...|..|.|.
  Fly    85 -------EKFVSNPLNAFGLIRRLNQDWPKLQNYTQKPLGLEQLTAMQDIVSAAPESFDMNEKLK 142

  Fly   136 HLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVARKSDFPVARF-----WLESALEKLPS 195
            .:..:::.|:|....::.|::...:....:.:.|||.:|... |.:..|     |.:.|| ||  
  Fly   143 AMHRIETTYDLQPKDIAKGLLQRTEFNYRLLFRDCLALAYHK-FEIGEFKRSLLWFQEAL-KL-- 203

  Fly   196 ASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKAMA 260
                ||:       |.:.|:.....||.:    ..|.|.|:..:.|  .|||:  ....|:. ||
  Fly   204 ----STD-------GSLEIMNRLKEIELK----GFATAVAKRSIYL--SNQGL--TNETIDD-MA 248

  Fly   261 KKELPKGRGQKSKAKKQISKSTEQLLIEEI------------------CRGA-KQQVTTGSRFNH 306
            ..:|     |.:|.     ...|||:..|:                  |||. .::.....|:| 
  Fly   249 NSQL-----QDAKL-----MDLEQLISSELKQWINDDSTTPPTDHNLGCRGLFPKKSNLVCRYN- 302

  Fly   307 CQLDGSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEE-------DTKGV---S 361
               ..::.:|.|.|.::|.:|.|||||:.|:|::.|:..|:...|.|.|       |.|.:   .
  Fly   303 ---SSTNAFLKLAPLKMEEISRDPYIVMFHEVISDKDIEEMKGEITEMENGWTSLGDPKEIVSRV 364

  Fly   362 YQSLKLSKLAQKKLGRISRLLGLEILEL------------------DPWTGRRHGHEHITKLEHS 408
            |...|.|..:::...|||.:.|.::.|.                  |.:|.|      :.:::.:
  Fly   365 YWIRKESSFSKRINQRISDMTGFKLEEFPAIQLANFGVGGYFKPHYDFYTDR------LKEVDVN 423

  Fly   409 SEL-KHVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPV 472
            :.| ..:..::........||..|||.|::||...:|:.|.|...|   ..|..|.||..::|||
  Fly   424 NTLGDRIGSIIFYAGEVSQGGQTVFPDLKVAVEPKKGNALFWFNAF---DDSTPDPRSLHSVCPV 485

  Fly   473 LLG------------VQLSVIACQSNV 487
            |:|            .||.|..|...|
  Fly   486 LVGSRWTITKWLHYAPQLFVKPCSPRV 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 27/126 (21%)
CG18233NP_649044.3 P4Ha_N 34..163 CDD:285528 36/150 (24%)
ATP-synt_B <198..278 CDD:304375 27/113 (24%)
P4Hc 333..498 CDD:214780 40/174 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146332492
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.