DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG18234

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_649043.3 Gene:CG18234 FlyBaseID:FBgn0265268 Length:515 Species:Drosophila melanogaster

Alignment Length:532 Identity:114/533 (21%)
Similarity:217/533 (41%) Gaps:146/533 (27%)


  Fly    19 SVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIHSQVD----SVEE 79
            |:||         ::.|:|.|...|..:..|...|:.:::.:.   |.::|:.|:.:    :.||
  Fly    27 SIAG---------MKELVDLEGFFISEMESYTAALKNKIDLME---SLLQEVQSKREISRRNPEE 79

  Fly    80 YMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTL----PSEEDYEESLNHLLHL 140
            ::.:|||.|.:::|....|   .|.....|..|..|.|...:..|    ||:.|..:::..::.|
  Fly    80 FVAHPLNAFSLIRRLHEDW---TQAELLMLNQVGLEHLQAIETGLEEAQPSDNDLNDAIGGIISL 141

  Fly   141 QSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVARK-SDFPVARF---WLESALEKLPSASENST 201
            |..|.|..:.::.|::.|.:..:|::..:|..:|.. .:|...::   |.::|::..    .:..
  Fly   142 QQFYNLQPSDIANGLLMGQQYNASLTTLNCQALANACMNFNYDKYALNWFKAAVDHY----NDDR 202

  Fly   202 ESQRERESGRVHILEATLNIEYRAGEL----SRALATAEELLLLLPMNQGIQKAKRKIEKAMAKK 262
            :.|..||.           .::|..:|    :..|.|           :|.:||..|:.:.:|..
  Fly   203 DGQVYREV-----------FDFRLPDLYINYTSVLVT-----------KGFRKAAWKVLQDVADL 245

  Fly   263 ELPKGRGQKSKAKKQISKSTEQLLIEEICRGAKQQV------------TTG-------SRFNHCQ 308
            :                 :|..||.::|....|..|            .||       |:...|.
  Fly   246 D-----------------ATLWLLRKDIYEVGKIDVPDPTFIITPWFDVTGCLRVGQTSQHLSCH 293

  Fly   309 LD-GSSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQS-------- 364
            .: .:|.:|.:.|.::|.:|..|:|||:|||:...|.:::          |.:|..|        
  Fly   294 YEKNTSEFLRIAPLKVETLSLKPHIVLYHDVIYDSEISKV----------KNISLPSLKSPLRIL 348

  Fly   365 ------LKLSKLA---QKKLG-RISRLLGLEILE-----LDPW--TGRRHGH-EHITKLEHSSEL 411
                  ||.:|:.   |..|. ||..:.|.::.|     :|.:  .|.|:.| ::|...:.::||
  Fly   349 YAIDYNLKFAKIREDHQSPLSLRIKDMTGEDVQEDTDFQIDNYGICGFRNFHTDNIELQDQTAEL 413

  Fly   412 -KHVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSG------QAI 469
             ..:..:|..:.....|||:.||.|.|.:...:||.|.||         ..|:|..      ...
  Fly   414 GDRLTSIMFFMNDVAQGGALAFPNLNLTIWPQKGSALVWR---------NLDHRMQPNQDLLHVS 469

  Fly   470 CPVLLGVQLSVI 481
            |||::|.:.:::
  Fly   470 CPVVVGSKWTLV 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 31/134 (23%)
CG18234NP_649043.3 P4Ha_N 27..157 CDD:285528 34/145 (23%)
P4Hc <371..485 CDD:214780 30/121 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146328384
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D391515at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.