DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG4174

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001034031.2 Gene:CG4174 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster

Alignment Length:512 Identity:122/513 (24%)
Similarity:200/513 (39%) Gaps:120/513 (23%)


  Fly    16 LVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRETSAIEEIHSQVDSVEEY 80
            :|.:....:||...|...:||..:...::.|:.|.:.|::.|::|||   ||.:....:.|.:..
  Fly    20 VVSAPESYDFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRR---AIRQSEELLKSTKTS 81

  Fly    81 MGNPLNVFGILKRFESVWP----------GLEQKANATLEMVFGERLSDRQLT-LPSEEDYEESL 134
            ..|.:..:.:|:...:.||          ||||.|           :|...|| .|:..|:|||:
  Fly    82 PRNLIYGYKVLRHLHNDWPQYFRLLKKDLGLEQIA-----------VSQMLLTQQPTSVDFEESM 135

  Fly   135 NHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWG--DCLEVARK----SDFPVARFWLESALEKL 193
            ..:..||:||.|||.:::.|.::. |..:..:|.  :||.:...    .|:..:..|||.||...
  Fly   136 GAMHRLQTVYNLDSYAMTEGFIDD-KDKNIRNWSADECLMLGLMYLFLKDYNQSENWLELALYHY 199

  Fly   194 PSASEN-STESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEK 257
               .:| |.|..:.:.....::||:.:......|....|...|.|||.:.|.:..:.....|:  
  Fly   200 ---DDNVSPEVLKIKLWNYPNLLESLVEANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKL-- 259

  Fly   258 AMAKKELPKGRGQKSKAKK--QISKSTEQLLIEEICRGAKQQVTTGSRFNH------CQLDGSSP 314
                |.|.....:.:|.||  |:.|        |||         ..|:..      |:....:|
  Fly   260 ----KHLQSNPAKLTKPKKVFQLQK--------EIC---------SKRYRRKSGVLVCRYVDWTP 303

  Fly   315 WLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLIDEEEDTKGVSYQSLK----LSKLAQKKL 375
            :|.|.|.::|.:|..|||.:.:..|..|:...|          |.||...|:    ||.....|:
  Fly   304 FLKLAPLKMEELSMKPYISIFYGFLGQKDIEVL----------KNVSRPKLQRIEHLSGNCSCKI 358

  Fly   376 GRISR--------------------LLGLEILELDPW--TGRRHGHEHITKLEHSSELKHVARLM 418
            |.:|.                    |.|.::||:..:  .|..:..|        .::.:.|...
  Fly   359 GNLSTSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNPEE--------PKIHNKANAF 415

  Fly   419 LNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLG 475
            :.|...|.||.:|||...|.|...:||:|.|.     .......|..    ||:|.|
  Fly   416 IFLSNAGKGGEIVFPSRHLKVRPRKGSMLVWE-----NLKKSLIYHQ----CPILKG 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 38/137 (28%)
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 38/138 (28%)
TPR repeat 169..197 CDD:276809 8/28 (29%)
TPR repeat 202..245 CDD:276809 11/43 (26%)
2OG-FeII_Oxy <362..470 CDD:304390 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146330229
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.