DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG34041

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster

Alignment Length:479 Identity:104/480 (22%)
Similarity:181/480 (38%) Gaps:93/480 (19%)


  Fly     6 SVLW-------LLQLFLLVESVAGANFARGEEQLQALLDTETQLIDGLRDYIERLERQLEEIRRE 63
            ||:|       ||.:.:|.:..:..       :::|.||.:|:|...||.|.|.|:..:..:.| 
  Fly     7 SVMWSALGFSPLLAVLILPKWASST-------KMKAYLDLDTRLKTQLRGYSEDLQDHISTLNR- 63

  Fly    64 TSAIEEIHSQVDSV----EEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGERLSDRQLTL 124
              .|::..|::|.|    |.|:|||||.|.:|......||...:.....|...:...:.:....:
  Fly    64 --YIDDRKSELDKVGKDPEVYLGNPLNSFSLLHHLHFDWPAWRKLMEKPLATEYITEIQEMWSEM 126

  Fly   125 PSEEDYEESLN-----HLLHLQSVYE---LDSNSLSLG----------------VVNGFKLGSSM 165
            |::::|..|:.     |....|..:|   |:|..::|.                .:||:| ..|:
  Fly   127 PTKDEYTNSIKAAKDFHKNETQGNFEFSPLESLQIALHAYDKKNYTEAENWLNITLNGYK-NLSL 190

  Fly   166 SWGDCLEVARKSDFPVARFWLESALEKLPSASENSTESQRERE---SGRVHILEATLNIEY--RA 225
            ...|..||..    ||...:.|:....:.:.|.....|..:.|   .....||...|.|.|  .:
  Fly   191 QEKDLYEVLS----PVIMVYDETNGAAMIAKSYIRYFSNHQMEFIVMKSACILSVGLIIVYLSYS 251

  Fly   226 GELSRALATAEELLLLLPMNQGIQKAKRKIEKAMAKKELPKGRGQKSKAKKQISKSTEQLLIEEI 290
            ...:|...:..:::.:|.:.:.:.|.......|:..|...........|...|....::|.|   
  Fly   252 NSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDKLAI--- 313

  Fly   291 CRGAKQQVTTGSRFNHCQLDGSSPWLLLQ--PSRLE---PVSSDPYIVLHHDVLTPKESNELLQL 350
               |...|.:.|..:|.|.|.:...|.||  |.:.|   .:|...|:...:|:      :|:...
  Fly   314 ---ASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDI------SEVCHG 369

  Fly   351 IDEEEDTKGVSYQSLKLSKLAQKKLGRISRLLGLEILELDPWTGRRHGHEHITKL-------EHS 408
            |.:..:...::.|.:....:...:...||..|.||.|.::....|     |:..|       :||
  Fly   370 ISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNR-----HLMSLRDCVALSDHS 429

  Fly   409 SELK---------HVARLMLNLQA 423
            .|:|         :||..||...|
  Fly   430 MEMKDYNKSKEWLNVAISMLESSA 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 36/154 (23%)
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528 30/119 (25%)
P4Ha_N 260..389 CDD:285528 25/141 (18%)
TPR repeat 452..491 CDD:276809 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146333328
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.