DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31371 and CG18749

Sequence 1:NP_733375.2 Gene:CG31371 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001027154.1 Gene:CG18749 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster

Alignment Length:526 Identity:126/527 (24%)
Similarity:218/527 (41%) Gaps:108/527 (20%)


  Fly    17 VESVAGANFARGEEQLQALLDTETQLIDGLRDYIERL-------ERQLEEIRRETSAIEEIHSQV 74
            |.|....::|....:|..||:.|.:|:|.|:.|::.|       ||.|.::.||...::      
  Fly    24 VNSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFNLMERSLIDMSRENMEMK------ 82

  Fly    75 DSVEEYMGNPLNVFGILKRFESVWPGLEQKA----NATLEMVFGERLSDRQLTLPSEEDYEESLN 135
            ...|.|:|||||.|.::.|..:.|....|.|    |..|..:...||..:.  ||:..|.:::..
  Fly    83 SDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLMRKM--LPTSSDLQQACR 145

  Fly   136 HLLHLQSVYELDSNSLSLGVVNGF-KLGSSMSWGDCLEVA------RKSDFPVARFWLESALEKL 193
            .:..|...|:|....|:.|.:.|: :.|:.::..|||.:.      :|.|  :|..|...:|.:.
  Fly   146 GIHDLMYFYDLKPEELAAGNLAGYSQPGTGLTAYDCLALGEFGVQNQKDD--LAEAWYNLSLTRF 208

  Fly   194 PSASENSTESQRERESGRVHILEATLNIEYRAGELSRALATAEELLLLLPMNQGIQKAKRKIEKA 258
            .:..|..          :||                :|.|      |||..|:.:.:|.:..|..
  Fly   209 DNIIEKY----------QVH----------------KAWA------LLLAKNKQLTEAFQHFENK 241

  Fly   259 MAKKELPKGRGQKSKAKKQISKSTEQLLIEEI------CRGAKQQVTTGSRFNHCQLDGS-SPWL 316
                  |:|          |..|.|.:..|.:      |....|:   .|:..||:.:.| :|:.
  Fly   242 ------PEG----------IVASNEVIHFEGVLATTQNCTAVVQK---PSKKLHCRYNTSTTPFT 287

  Fly   317 LLQPSRLEPVSSDPYIVLHHDVLTPKESNELLQLID--EEEDTKGVSYQSLKLSK----LAQKKL 375
            .:.|.::|.:..|||:|:.|||:...|.:.:|...|  ..|...|:. ..::.||    :..|.|
  Fly   288 RIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSDFGLSESVSGLK-SEVRTSKDSHIVDAKTL 351

  Fly   376 G-RISRLLGLEILELDPWTGRRHG-------HEHITKLEHSSELK---HVARLMLNLQAPGMGGA 429
            . |::.:.||.:...||::...:|       |....:..:::.||   .:|.::..|:....|||
  Fly   352 NERVTDMTGLSMEMSDPFSLINYGLGGHFILHHDFHEYTNTTRLKQGDRIATVLFYLREVDSGGA 416

  Fly   430 VVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLGVQLSVIACQSNVLRDTLYG 494
            .|||.|.:.|...:||.:.|......|:.:.   ::....|||:.|.:. |:....|.|......
  Fly   417 TVFPMLNITVMPKKGSAVFWYNLHNSGAVNS---KTLHTACPVISGSKY-VLTKWINELPQMFVT 477

  Fly   495 PRGQDS 500
            |..:||
  Fly   478 PCMKDS 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 38/137 (28%)
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528 38/139 (27%)
P4Hc 314..468 CDD:214780 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146327413
eggNOG 1 0.900 E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10869
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.